Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Claudin-3 (CLDN3) Recombinant Protein | CLDN3 recombinant protein

Recombinant Human Claudin-3 (CLDN3)

Gene Names
CLDN3; RVP1; HRVP1; C7orf1; CPE-R2; CPETR2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Claudin-3 (CLDN3); Recombinant Human Claudin-3 (CLDN3); Recombinant Claudin-3 (CLDN3); Claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2 Rat ventral prostate.1 protein homolog; hRVP1; CLDN3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-80. Partial.
Sequence
RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Sequence Length
80
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for CLDN3 recombinant protein
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Product Categories/Family for CLDN3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,319 Da
NCBI Official Full Name
claudin-3
NCBI Official Synonym Full Names
claudin 3
NCBI Official Symbol
CLDN3
NCBI Official Synonym Symbols
RVP1; HRVP1; C7orf1; CPE-R2; CPETR2
NCBI Protein Information
claudin-3; CPE-R 2; CPE-receptor 2; ventral prostate.1-like protein; ventral prostate.1 protein homolog; Clostridium perfringens enterotoxin receptor 2
UniProt Protein Name
Claudin-3
Protein Family
UniProt Gene Name
CLDN3
UniProt Synonym Gene Names
C7orf1; CPETR2; CPE-R 2; CPE-receptor 2; hRVP1
UniProt Entry Name
CLD3_HUMAN

NCBI Description

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat. [provided by RefSeq, Jul 2008]

Uniprot Description

Claudin-3: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. CLDN3 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Belongs to the claudin family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Cytoskeletal

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: tight junction; integral to plasma membrane; integral to membrane; lateral plasma membrane

Molecular Function: identical protein binding; transmembrane receptor activity; structural molecule activity

Biological Process: response to hypoxia; signal transduction; calcium-independent cell-cell adhesion

Research Articles on CLDN3

Similar Products

Product Notes

The CLDN3 cldn3 (Catalog #AAA1106445) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-80. Partial. The amino acid sequence is listed below: RVSAFIGSNI ITSQNIWEGL WMNCVVQSTG QMQCKVYDSL LALPQDLQAA R . It is sometimes possible for the material contained within the vial of "Claudin-3 (CLDN3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.