Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Claudin-18 (CLDN18) Recombinant Protein | CLDN18 recombinant protein

Recombinant Human Claudin-18 (CLDN18), partial

Gene Names
CLDN18; SFTA5; SFTPJ; DKFZp564B2062
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Claudin-18 (CLDN18); Recombinant Human Claudin-18 (CLDN18); partial; Claudin-18; CLDN18 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-80aa, Partial of Isoform A2
Sequence
DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR
Species
Homo sapiens (Human)
Relevance
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for CLDN18 recombinant protein
References
"Claudin-18 is an early-stage marker of pancreatic carcinogenesis."Tanaka M., Shibahara J., Fukushima N., Shinozaki A., Umeda M., Ishikawa S., Kokudo N., Fukayama M.J Histochem Cytochem 59:942-952(2011)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,856 Da
NCBI Official Full Name
claudin-18 isoform 2
NCBI Official Synonym Full Names
claudin 18
NCBI Official Symbol
CLDN18
NCBI Official Synonym Symbols
SFTA5; SFTPJ; DKFZp564B2062
NCBI Protein Information
claudin-18; OTTHUMP00000216399; OTTHUMP00000216400; surfactant associated 5; surfactant associated protein J; surfactant, pulmonary associated protein J
UniProt Protein Name
Claudin-18
Protein Family
UniProt Gene Name
CLDN18
UniProt Entry Name
CLD18_HUMAN

NCBI Description

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Uniprot Description

Claudin-18: a multi-pass membrane protein with calcium-independent cell-adhesion activity that plays a major role in the formation of tight junctions. Belongs to the claudin family. Two isoforms of the human protein are produced by alternative splicing. Isoform 2 is a specific cell lineage marker. Its expression in normal tissues is restricted to differentiated epithelial cells of the gastric mucosa; it is absent from the gastric stem cells. Isoform 2 is expressed in a significant proportion of primary gastric cancers and metastases, as well as in subtypes of pancreatic, esophageal, ovarian, and lung tumors.

Protein type: Cell adhesion; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q22.3

Cellular Component: tight junction; integral to membrane; plasma membrane

Molecular Function: identical protein binding; structural molecule activity

Biological Process: intercellular junction assembly and maintenance; calcium-independent cell-cell adhesion

Research Articles on CLDN18

Similar Products

Product Notes

The CLDN18 cldn18 (Catalog #AAA9018475) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-80aa, Partial of Isoform A2. The amino acid sequence is listed below: DQWSTQDLYN NPVTAVFNYQ GLWRSCVRES SGFTECRGYF TLLGLPAMLQ AVR. It is sometimes possible for the material contained within the vial of "Claudin-18 (CLDN18), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.