AP-1-like transcription factor YAP4 (CIN5) Recombinant Protein | CIN5 recombinant protein

Recombinant Saccharomyces cerevisiae AP-1-like transcription factor YAP4 (CIN5)

Cat. Num. AAA1225492

• Gene Names: CIN5; HAL6; YAP4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: AP-1-like transcription factor YAP4 (CIN5); Recombinant Saccharomyces cerevisiae AP-1-like transcription factor YAP4 (CIN5); CIN5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-295, full length protein
• Sequence: MLMQIKMDNHPFNFQPILASHSMTRDSTKPKKMTDTAFVPSPPVGFIKEENKADLHTISVVASNVTLPQIQLPKIATLEEPGYESRTGSLTDLSGRRNSVNIGALCEDVPNTAGPHIARPVTINNLIPPSLPRLNTYQLRPQLSDTHLNCHFNSNPYTTASHAPFESSYTTASTFTSQPAASYFPSNSTPATRKNSATTNLPSEERRRVSVSLSEQVFNEGERYNNDGQLIGKTGKPLRNTKRAAQNRSAQKAFRQRREKYIKNLEEKSKLFDGLMKENSELKKMIESLKSKLKE
• Sequence Length: 295

• Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 6324602
• NCBI GeneID: 854193
• NCBI Accession #: NP_014671.1
• NCBI GenBank Nucleotide #: NM_001183447.1
• UniProt Accession #: P40917; D6W294
• Molecular Weight: 32,975 Da
• NCBI Official Full Name: Cin5p
• NCBI Official Symbol: CIN5
• NCBI Official Synonym Symbols: HAL6; YAP4
• NCBI Protein Information: Cin5p
• UniProt Protein Name: AP-1-like transcription factor YAP4
• Protein Family: AP-1-like transcription factor
• UniProt Gene Name: CIN5
• UniProt Synonym Gene Names: HAL6; SDS15; YAP4

Uniprot Description

Transcription activator involved in the regulation of genes expressed in response to environmental changes and metabolic requirements. According to genome-wide promoter binding and gene expression studies it regulates, among others, genes involved in ribosome biogenesis, and protein synthesis. It may also be involved in pleiotropic drug resistance. When overexpressed it confers increased resistance to cisplatin, the DNA-alkylating agents methylmethanosulfonate, and mitomycin C, the antimalarial drugs quinidine, mefloquine, and chloroquine, and increases cellular tolerance to sodium and lithium. Preferentially binds 5'-TTACTAA-3'.