Friend of PRMT1 protein (Fop) Recombinant Protein | Fop recombinant protein
Recombinant Mouse Friend of PRMT1 protein (Fop)
Gene Names
Chtop; Fop; Srag; 2500003M10Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Friend of PRMT1 protein (Fop); Recombinant Mouse Friend of PRMT1 protein (Fop); Fop recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-249, full length protein
Sequence
AAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Sequence Length
248
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,243 Da
NCBI Official Full Name
chromatin target of PRMT1 protein isoform 1
NCBI Official Synonym Full Names
chromatin target of PRMT1
NCBI Official Symbol
Chtop
NCBI Official Synonym Symbols
Fop; Srag; 2500003M10Rik
NCBI Protein Information
chromatin target of PRMT1 protein
UniProt Protein Name
Chromatin target of PRMT1 protein
UniProt Gene Name
Chtop
UniProt Synonym Gene Names
Fop; SRAG
Uniprot Description
Plays an important role in the ligand-dependent activation of estrogen receptor target genes (). May play a role in the silencing of fetal globin genes (PubMed:20688955). Recruits the 5FMC complex to ZNF148, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes (PubMed:22872859). Required for the tumorigenicity of glioblastoma cells. Binds to 5-hydroxymethylcytosine (5hmC) and associates with the methylosome complex containing PRMT1, PRMT5, MEP50 and ERH. The CHTOP-methylosome complex associated with 5hmC methylates H4R3 and transactivates genes involved in glioblastomagenesis (PubMed:25284789).
Research Articles on Fop
Similar Products
Product Notes
The Fop chtop (Catalog #AAA1472239) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-249, full length protein. The amino acid sequence is listed below: AAQSAPKVVL KSTTKMSLNE RFTNMLKNKQ PMPVNIRASM QQQQQLASAR NRRLAQQMEN RPSVQAALKL KQKSLKQRLG KSNIQARLGR PIGALARGAI GGRGLPIIQR GLPRGGLRGG RATRTLLRGG MSLRGQNLLR GGRAVAPRMG LRRGGVRGRG GPGRGGLGRG AMGRGGIGGR GRGMIGRGRG GFGGRGRGRG RGRGALTRPV LTKEQLDNQL DAYMSKTKGH LDAELDAYMA QTDPETND. It is sometimes possible for the material contained within the vial of "Friend of PRMT1 protein (Fop), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
