Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Neuronal acetylcholine receptor subunit alpha-5 (Chrna5) Recombinant Protein | Chrna5 recombinant protein

Recombinant Rat Neuronal acetylcholine receptor subunit alpha-5 (Chrna5)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Neuronal acetylcholine receptor subunit alpha-5 (Chrna5); Recombinant Rat Neuronal acetylcholine receptor subunit alpha-5 (Chrna5); Recombinant Neuronal acetylcholine receptor subunit alpha-5 (Chrna5); Neuronal acetylcholine receptor subunit alpha-5; Chrna5 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-452
Sequence
AAKHEDSLFRDLFEDYERWVRPVEHLSDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKIIRVPSDSLWIPDIVLFDNADGRFEGASTKTVVRYNGTVTWTQPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDRTDFFDNGEWEIMSAMGSKGNRTDSCCWYPYITYSFVIKRLPLFYTLFLIIPCIGLSFLTVVVFYLPSNEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPWVRKIFLHKLPKLLCMRSHADRYFTQREEAESGAGPKSRNTLEAALDCIRYITRHVVKENDVREVVEDWKFIAQVLDRMFLWTFLLVSIIGTLGLFVPVIYKWANIIVPVHIGNTIK
Sequence Length
452
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
51,874 Da
NCBI Official Full Name
Neuronal acetylcholine receptor subunit alpha-5
NCBI Official Synonym Full Names
cholinergic receptor, nicotinic, alpha 5 (neuronal)
NCBI Official Symbol
Chrna5
NCBI Protein Information
neuronal acetylcholine receptor subunit alpha-5; acetylcholine receptor alpha 5; cholinergic receptor, nicotinic, alpha polypeptide 5
UniProt Protein Name
Neuronal acetylcholine receptor subunit alpha-5
UniProt Gene Name
Chrna5
UniProt Synonym Gene Names
Acra5
UniProt Entry Name
ACHA5_RAT

NCBI Description

neuronal receptor and ion channel activated by acetylcholine; mediates release of catecholamines into bloodstream [RGD, Feb 2006]

Uniprot Description

Function: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Subunit structure: Neuronal AChR seems to be composed of two different types of subunits: alpha and non-alpha (beta).

Subcellular location: Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-5/CHRNA5 sub-subfamily. [View classification]

Research Articles on Chrna5

Similar Products

Product Notes

The Chrna5 chrna5 (Catalog #AAA947936) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-452. The amino acid sequence is listed below: AAKHEDSLFR DLFEDYERWV RPVEHLSDKI KIKFGLAISQ LVDVDEKNQL MTTNVWLKQE WIDVKLRWNP DDYGGIKIIR VPSDSLWIPD IVLFDNADGR FEGASTKTVV RYNGTVTWTQ PANYKSSCTI DVTFFPFDLQ NCSMKFGSWT YDGSQVDIIL EDQDVDRTDF FDNGEWEIMS AMGSKGNRTD SCCWYPYITY SFVIKRLPLF YTLFLIIPCI GLSFLTVVVF YLPSNEGEKI SLCTSVLVSL TVFLLVIEEI IPSSSKVIPL IGEYLVFTMI FVTLSIMVTV FAINIHHRSS STHNAMAPWV RKIFLHKLPK LLCMRSHADR YFTQREEAES GAGPKSRNTL EAALDCIRYI TRHVVKENDV REVVEDWKFI AQVLDRMFLW TFLLVSIIGT LGLFVPVIYK WANIIVPVHI GNTIK. It is sometimes possible for the material contained within the vial of "Neuronal acetylcholine receptor subunit alpha-5 (Chrna5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.