Muscarinic acetylcholine receptor M3 (CHRM3) Recombinant Protein | CHRM3 recombinant protein

Recombinant Pig Muscarinic acetylcholine receptor M3 (CHRM3)

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

Muscarinic acetylcholine receptor M3 (CHRM3); Recombinant Pig Muscarinic acetylcholine receptor M3 (CHRM3); Recombinant Muscarinic acetylcholine receptor M3 (CHRM3); Muscarinic acetylcholine receptor M3; CHRM3 recombinant protein

Ordering

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

1-590

Sequence

MTLHNNNTTSPLFPNISSSWIHGPSDAGLPPGTVTHFGSYNISQAAGNFSSPNGTTSDPLGGHTIWQVVFIAFLTGILALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFILWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSLKRSARRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGTVDLERKASKLQAQKSMDDGGSFQKSFSKLPIQLESAVDTAKASDVNSSVGKTTATLPLSFKEATLAKRFALKTRSQITKRKRMSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL

Sequence Length

590

Species

Sus scrofa (Pig)

Preparation and Storage

Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #

178057169

NCBI GeneID

100144478

NCBI Accession #

NP_001116570.1

NCBI GenBank Nucleotide #

NM_001123098.1

UniProt Accession #

P11483

Molecular Weight

66,078 Da

NCBI Official Full Name

muscarinic acetylcholine receptor M3

NCBI Official Symbol

CHRM3

NCBI Protein Information

muscarinic acetylcholine receptor M3

UniProt Protein Name

Muscarinic acetylcholine receptor M3

Protein Family

Muscarinic acetylcholine receptor

UniProt Gene Name

CHRM3

UniProt Entry Name

ACM3_PIG

Uniprot Description

Function: The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity. Cell junction › synapse › postsynaptic cell membrane; Multi-pass membrane protein

By similarity. Basolateral cell membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family. Muscarinic acetylcholine receptor subfamily. CHRM3 sub-subfamily.

Research Articles on CHRM3

1. Data suggest that both M(2) and M(3) muscarinic receptors mediate the contraction in both pig clasp and sling fibers similar to human clasp and sling fibers.

Similar Products

CHRM3 Recombinant Protein

Host: E Coli or Yeast or Baculovirus or Mammalian Cell

Reactivity: n/a

Apps: n/a

Product Notes

The CHRM3 chrm3 (Catalog #AAA952001) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-590. The amino acid sequence is listed below: MTLHNNNTTS PLFPNISSSW IHGPSDAGLP PGTVTHFGSY NISQAAGNFS SPNGTTSDPL GGHTIWQVVF IAFLTGILAL VTIIGNILVI VAFKVNKQLK TVNNYFLLSL ACADLIIGVI SMNLFTTYII MNRWALGNLA CDLWLSIDYV ASNASVMNLL VISFDRYFSI TRPLTYRAKR TTKRAGVMIG LAWVISFILW APAILFWQYF VGKRTVPPGE CFIQFLSEPT ITFGTAIAAF YMPVTIMTIL YWRIYKETEK RTKELAGLQA SGTEAEAENF VHPTGSSRSC SSYELQQQSL KRSARRKYGR CHFWFTTKSW KPSAEQMDQD HSSSDSWNNN DAAASLENSA SSDEEDIGSE TRAIYSIVLK LPGHSTILNS TKLPSSDNLQ VPEEELGTVD LERKASKLQA QKSMDDGGSF QKSFSKLPIQ LESAVDTAKA SDVNSSVGKT TATLPLSFKE ATLAKRFALK TRSQITKRKR MSLIKEKKAA QTLSAILLAF IITWTPYNIM VLVNTFCDSC IPKTYWNLGY WLCYINSTVN PVCYALCNKT FRTTFKMLLL CQCDKRKRRK QQYQQRQSVI FHKRVPEQAL. It is sometimes possible for the material contained within the vial of "Muscarinic acetylcholine receptor M3 (CHRM3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...