mRNA interferase ChpB (chpB) Recombinant Protein | chpB recombinant protein

Recombinant Escherichia coli mRNA interferase ChpB (chpB)

Cat. Num. AAA1091538

• Gene Names: chpB; chpBK; ECK4221; JW4184; yjfE
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: mRNA interferase ChpB (chpB); Recombinant Escherichia coli mRNA interferase ChpB (chpB); chpB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-116, full length protein
• Sequence: MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLVNQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
• Sequence Length: 116

• Species: Escherichia coli (strain K12)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 16132047
• NCBI GeneID: 948747
• NCBI Accession #: NP_418646.1
• NCBI GenBank Nucleotide #: NC_000913.3
• UniProt Accession #: P33647; Q2M680
• Molecular Weight: 12,492 Da
• NCBI Official Full Name: toxin of the ChpB-ChpS toxin-antitoxin system
• NCBI Official Symbol: chpB
• NCBI Official Synonym Symbols: chpBK; ECK4221; JW4184; yjfE
• NCBI Protein Information: toxin of the ChpB-ChpS toxin-antitoxin system
• UniProt Protein Name: Endoribonuclease toxin ChpB
• Protein Family: Endoribonuclease
• UniProt Gene Name: chpB
• UniProt Synonym Gene Names: chpBK; yjfE

NCBI Description

ChpB(ChpBK) is a sequence-specific (ACY) endoribonuclease. [More information is available at EcoGene: EG12096]. ChpB is the toxin component of the ChpB-ChpS toxin-antitoxin system. [More information is available at EcoCyc: EG12096].

Uniprot Description

Toxic component of a type II toxin-antitoxin (TA) system. ChpB is a sequence-specific mRNA and (weak) tmRNA endoribonuclease that inhibits protein synthesis and induces bacterial stasis. Cleavage is independent of the ribosome. Cleavage occurs at ACY sequences where Y is not C. The endoribonuclease activity is not as strong as that of MazF. The endoribonuclease activity (a toxin) is inhibited by its labile cognate antitoxin ChpS. Toxicity results when the levels of ChpS decrease in the cell, leading to mRNA degradation. Both ChpS and ChpB probably bind to the promoter region of the chpS-chpB operon to autoregulate their synthesis. mRNA interferases play a role in bacterial persistence to antibiotics (PubMed:21788497).