Calcium-binding protein p22 (CHP) Recombinant Protein | CHP recombinant protein

Recombinant Human Calcium-binding protein p22 (CHP)

Cat. Num. AAA1470235

• Gene Names: CHP1; CHP; p22; p24; Sid470p; SLC9A1BP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Calcium-binding protein p22 (CHP); Recombinant Human Calcium-binding protein p22 (CHP); CHP recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-195, Full length protein
• Sequence: GSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH
• Sequence Length: 194

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 6005731
• NCBI GeneID: 11261
• NCBI Accession #: NP_009167.1
• NCBI GenBank Nucleotide #: NM_007236.4
• UniProt Accession #: Q99653; Q6FHZ9; B2R6H9
• Molecular Weight: 22,456 Da
• NCBI Official Full Name: calcineurin B homologous protein 1
• NCBI Official Synonym Full Names: calcineurin like EF-hand protein 1
• NCBI Official Symbol: CHP1
• NCBI Official Synonym Symbols: CHP; p22; p24; Sid470p; SLC9A1BP
• NCBI Protein Information: calcineurin B homologous protein 1
• UniProt Protein Name: Calcineurin B homologous protein 1
• Protein Family: Chaoptin
• UniProt Gene Name: CHP1
• UniProt Synonym Gene Names: CHP

NCBI Description

This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq, Jul 2008]

Uniprot Description

Calcium-binding protein involved in different processes such as regulation of vesicular trafficking, plasma membrane Na+/H+ exchanger and gene transcription. Involved in the constitutive exocytic membrane traffic. Mediates the association between microtubules and membrane-bound organelles of the endoplasmic reticulum and Golgi apparatus and is also required for the targeting and fusion of transcytotic vesicles (TCV) with the plasma membrane. Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na+/H+ exchange activity. Affects the pH sensitivity of SLC9A1/NHE1 by increasing its sensitivity at acidic pH. Required for the stabilization and localization of SLC9A1/NHE1 at the plasma membrane. Inhibits serum- and GTPase-stimulated Na+/H+ exchange. Plays a role as an inhibitor of ribosomal RNA transcription by repressing the nucleolar UBF1 transcriptional activity. May sequester UBF1 in the nucleoplasm and limit its translocation to the nucleolus. Associates to the ribosomal gene promoter. Acts as a negative regulator of the calcineurin/NFAT signaling pathway. Inhibits NFAT nuclear translocation and transcriptional activity by suppressing the calcium-dependent calcineurin phosphatase activity. Also negatively regulates the kinase activity of the apoptosis-induced kinase STK17B. Inhibits both STK17B auto- and substrate-phosphorylations in a calcium-dependent manner.