muIgFc Protein
muIgFc-Biotin
Reactivity
Human
Applications
Flow Cytometry, Functional Assay, ELISA
Synonyms
muIgFc; muIgFc-Biotin; Recombinant muIg/Biotin Control Protein; muIgFc protein
Host
CHO cells
Reactivity
Human
Form/Format
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 5% Glycerol, 0.2% BSA.
Concentration
0.25 mg/ml (varies by lot)
Applicable Applications for muIgFc protein
Flow Cytometry (FC/FACS), ELISA (EIA)
Molecular Structure
A soluble fusion protein consisting of residual murine CD8 signal peptide and linker: (1)kpqapelrgsagt(13)
fused to murine IgG2a Fc and hinge regions: (14)eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk(246)
Predicted non glycosylated monomeric molecular weight: 27.8 kd. In SDS-PAGE, the protein migrates at ~55kd non reduced, and ~30kd reduced.
Transfectant Cell Line
CHO
Cells Tested
Human PBMC, HPB-MLT, Nalm-6, U-937 and Raji (cells were pre blocked with human IgG to prevent non specific binding).
Performance
Recombinant muIg/Biotin was reactive in Goat anti-mouse Ig EIA utilizing SA/HRP as a detector. Product was tested as a negative control in Flow cytometry at 10 ug/ml using Streptavidin/R-PE) as a 2 degree reagent. All cells tested failed to stain or display a significant mean shift above a buffer background.
Conjugation
Biotin
Production
Recombinant protein from (low FBS containing) tissue culture supernatant of transfectants was purified using affinity and size exclusion chromatography), and reacted with NHS-Biotin. Unconjugated Biotin was removed from conjugate by size exclusion chromatography.
Buffer
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 5% Glycerol, 0.2% BSA, 0.04% NaN3 (as a preservative).
Preparation and Storage
Store at 2 - 5 degree C. Freeze/Thawing is not recommended.
Product should retain activity for at least 12 months after shipping date when stored as recommended.
Product should retain activity for at least 12 months after shipping date when stored as recommended.
Related Product Information for muIgFc protein
Information: Recombinant muIg control protein was engineered to be a negative control for murine IgG2a Fc containing fusion proteins.
Similar Products
Product Notes
The muIgFc (Catalog #AAA666830) is a Protein produced from CHO cells and is intended for research purposes only. The product is available for immediate purchase. The muIgFc-Biotin reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's muIgFc can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), ELISA (EIA). Researchers should empirically determine the suitability of the muIgFc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "muIgFc, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
