Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

muIgFc Protein

muIgFc-Purified (with Antibiotics)

Reactivity
Human
Applications
Flow Cytometry, Functional Assay, ELISA
Purity
Purified (with Antibiotics)
Synonyms
muIgFc; muIgFc-Purified (with Antibiotics); Recombinant muIg Control Protein; muIgFc protein
Ordering
For Research Use Only!
Host
CHO cells
Reactivity
Human
Purity/Purification
Purified (with Antibiotics)
Form/Format
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5% Gentamicin sulfate
Concentration
0.5 mg/ml (varies by lot)
Applicable Applications for muIgFc protein
Flow Cytometry (FC/FACS), ELISA (EIA)
Molecular Structure
A soluble fusion protein consisting of residual murine CD8 signal peptide and linker: (1)kpqapelrgsagt(13) fused to murine IgG2a Fc and hinge regions: (14)eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk(246) Predicted non glycosylated monomeric molecular weight: 27.8 kd. In SDS-PAGE, the protein migrates at ~55kd non reduced, and ~30kd reduced.
Transfectant Cell Line
CHO
Cells Tested
Human PBMC, HPB-MLT, Nalm-6, and Raji (cells were pre blocked with human IgG to prevent non specific binding).
Performance
Recombinant muIg was reactive in Goat anti-mouse Ig EIA. Product was tested as a negative control in Flow cytometry at 10 ug/ml using Goat anti-Mouse IgG/FITC as a 2 degree reagent. All cells tested failed to stain or display a significant mean shift above a buffer background.
Production
Recombinant protein from (low FBS containing) tissue culture supernatant of transfectants was purified using affinity and size exclusion chromatography.
Buffer
50 mM Sodium Phosphate pH 7.5, 100 mM Potassium Chloride, 150mM NaCl, 0.5 mg/ml Gentamicin Sulfate (as a preservative).
Group Header
muIgFc
Preparation and Storage
Store at 2 - 5 degree C. Freeze/Thawing is not recommended.
Product should retain activity for at least 12 months after shipping date when stored as recommended
Related Product Information for muIgFc protein
Information: Recombinant muIg control protein was engineered to be a negative control for muIg containing fusion proteins.

Similar Products

Product Notes

The muIgFc (Catalog #AAA666811) is a Protein produced from CHO cells and is intended for research purposes only. The product is available for immediate purchase. The muIgFc-Purified (with Antibiotics) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's muIgFc can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), ELISA (EIA). Researchers should empirically determine the suitability of the muIgFc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "muIgFc, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.