Chitinase-3-like protein 4 (Chi3l4) Recombinant Protein | Chi3l4 recombinant protein
Recombinant Mouse Chitinase-3-like protein 4 (Chi3l4)
Gene Names
Chil4; Ym2; Chi3l4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chitinase-3-like protein 4 (Chi3l4); Recombinant Mouse Chitinase-3-like protein 4 (Chi3l4); Chi3l4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-402, full length protein
Sequence
YQLMCYYTSWAKDRPTEGSFKPGNIDPCLCTHLIYAFAGMKNNEITYLSEQDLRDYEALNGLKDRNTELKTLLAIGGWKFGPAPFSSMVSTPQNRQTFIKSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVQEMRKAFEEESTLNHIPRLLLTSTGAGFIDVIKSGYKIPELSQSLDYIQVMTYDLHDPKNGYTGENSPLYKSPYDIGKSADLNVDSIITYWKDHGAASEKLIVGFPAYGHTFILSDPSKNGIGDPTVSAGPPGKYTNEQGLLAYFEICTFLNEGATEIFDATQEVPYAYLGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQGRFPLTTTLKRDLNVHSASCKASYRGEL
Sequence Length
381
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,975 Da
NCBI Official Full Name
chitinase-like protein 4
NCBI Official Synonym Full Names
chitinase-like 4
NCBI Official Symbol
Chil4
NCBI Official Synonym Symbols
Ym2; Chi3l4
NCBI Protein Information
chitinase-like protein 4
UniProt Protein Name
Chitinase-like protein 4
UniProt Gene Name
Chil4
UniProt Synonym Gene Names
Chi3l4; Ym2
Uniprot Description
Has low chemotactic activity for eosinophils. May play a role in inflammation and allergy. Has no chitinase activity.
Research Articles on Chi3l4
Similar Products
Product Notes
The Chi3l4 chil4 (Catalog #AAA1464983) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-402, full length protein. The amino acid sequence is listed below: YQLMCYYTSW AKDRPTEGSF KPGNIDPCLC THLIYAFAGM KNNEITYLSE QDLRDYEALN GLKDRNTELK TLLAIGGWKF GPAPFSSMVS TPQNRQTFIK SVIRFLRQYN FDGLNLDWQY PGSRGSPPKD KHLFSVLVQE MRKAFEEEST LNHIPRLLLT STGAGFIDVI KSGYKIPELS QSLDYIQVMT YDLHDPKNGY TGENSPLYKS PYDIGKSADL NVDSIITYWK DHGAASEKLI VGFPAYGHTF ILSDPSKNGI GDPTVSAGPP GKYTNEQGLL AYFEICTFLN EGATEIFDAT QEVPYAYLGN EWVGYDNVRS FKLKAQWLKD NNLGGAVVWP LDMDDFSGSF CHQGRFPLTT TLKRDLNVHS ASCKASYRGE L. It is sometimes possible for the material contained within the vial of "Chitinase-3-like protein 4 (Chi3l4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
