Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Chromogranin-A Recombinant Protein | CHGA recombinant protein

Recombinant Human Chromogranin-A

Gene Names
CHGA; CGA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chromogranin-A; Recombinant Human Chromogranin-A; Pituitary secretory protein I; SP-I; CHGA recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
224-457
Sequence
QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
Sequence Length
457
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for CHGA recombinant protein
Pancreastatin: Strongly inhibits glucose induced insulin release from the pancreas. Catestatin: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist. Displays antibacterial activity against Gram-positive bacteria S. aureus and M. luteus, and Gram-negative bacteria E Coli and P. aeruginosa. Can induce mast cell migration, degranulation and production of cytokines and chokines. Acts as a potent scavenger of free radicals in vitro. May play a role in the regulation of cardiac function and blood pressure.
Product Categories/Family for CHGA recombinant protein
References
The primary structure of human chromogranin A and pancreastatin.Konecki D.S., Benedum U.M., Gerdes H.-H., Huttner W.B.J. Biol. Chem. 262:17026-17030(1987)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53.8kD
NCBI Official Full Name
chromogranin-A isoform 1 preproprotein
NCBI Official Synonym Full Names
chromogranin A
NCBI Official Symbol
CHGA
NCBI Official Synonym Symbols
CGA
NCBI Protein Information
chromogranin-A
UniProt Protein Name
Chromogranin-A
Protein Family
UniProt Gene Name
CHGA
UniProt Synonym Gene Names
CgA; SP-I
UniProt Entry Name
CMGA_HUMAN

NCBI Description

The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Two other peptides, catestatin and chromofungin, have antimicrobial activity and antifungal activity, respectively. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]

Uniprot Description

CHGA: a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells and is a precursor to multiple biologically active peptides including vasostatin, pancreastatin, and chromostatin. Binds calcium with a low-affinity. Vasostatin negatively regulates angiogenesis and has antibacterial activity against some Gram-positive bacteria. Pancreastatin inhibits glucose induced insulin release from the pancreas. Chromostatin inhibits catecholamine release from chromaffin cells.

Protein type: Secreted; Vesicle; Cell adhesion; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 14q32

Cellular Component: extracellular space; mast cell granule; perinuclear region of cytoplasm

Biological Process: defense response to fungus; defense response to Gram-negative bacterium; defense response to Gram-positive bacterium; innate immune response; killing of cells of another organism; mast cell activation; mast cell chemotaxis; mast cell cytokine production; mast cell degranulation; negative regulation of catecholamine secretion; negative regulation of vasodilation; organelle organization and biogenesis; ovulation cycle; positive regulation of cAMP metabolic process; regulation of blood pressure; regulation of the force of heart contraction

Research Articles on CHGA

Similar Products

Product Notes

The CHGA chga (Catalog #AAA969491) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 224-457. The amino acid sequence is listed below: QAKREEEEEE EEEAEAGEEA VPEEEGPTVV LNPHPSLGYK EIRKGESRSE ALAVDGAGKP GAEEAQDPEG KGEQEHSQQK EEEEEMAVVP QGLFRGGKSG ELEQEEERLS KEWEDSKRWS KMDQLAKELT AEKRLEGQEE EEDNRDSSMK LSFRARAYGF RGPGPQLRRG WRPSSREDSL EAGLPLQVRG YPEEKKEEEG SANRRPEDQE LESLSAIEAE LEKVAHQLQA LRRG. It is sometimes possible for the material contained within the vial of "Chromogranin-A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.