Mitochondrial intermembrane space import and assembly protein 40 (CHCHD4) Recombinant Protein | CHCHD4 recombinant protein

Recombinant Bovine Mitochondrial intermembrane space import and assembly protein 40 (CHCHD4)

Cat. Num. AAA1290907

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mitochondrial intermembrane space import and assembly protein 40 (CHCHD4); Recombinant Bovine Mitochondrial intermembrane space import and assembly protein 40 (CHCHD4); CHCHD4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-137, full length protein
• Sequence: MAYCRQEGKDRIIFVTKEDHETPSNAELVADDPNDPYEEHGLILPNGDINWNCPCLGGMASGPCGEQFKAAFSCFHYSKEDVKGSDCVDQFRAMQECMQKYPDLYPQEEEEEEEQPADPLPEAASEASATKEAAASS
• Sequence Length: 137

• Species: Bovine
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 114051501
• NCBI GeneID: 513889
• NCBI Accession #: NP_001039624.1
• NCBI GenBank Nucleotide #: NM_001046159.2
• UniProt Accession #: Q2KHZ4
• Molecular Weight: 15,173 Da
• NCBI Official Full Name: mitochondrial intermembrane space import and assembly protein 40
• NCBI Official Synonym Full Names: coiled-coil-helix-coiled-coil-helix domain containing 4
• NCBI Official Symbol: CHCHD4
• NCBI Protein Information: mitochondrial intermembrane space import and assembly protein 40
• UniProt Protein Name: Mitochondrial intermembrane space import and assembly protein 40
• Protein Family: Mitochondrial intermembrane space import and assembly protein
• UniProt Gene Name: CHCHD4
• UniProt Synonym Gene Names: MIA40

Uniprot Description

Functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17 or MICU1. Required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS. Reduced CHCHD4/MIA40 is then reoxidized by GFER/ERV1 via a disulfide relay system. Mediates formation of disulfide bond in MICU1 in the IMS, promoting formation of the MICU1-MICU2 heterodimer that regulates mitochondrial calcium uptake.