Cholesterol 25-hydroxylase (CH25H) Recombinant Protein | CH25H recombinant protein
Recombinant Pig Cholesterol 25-hydroxylase (CH25H)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cholesterol 25-hydroxylase (CH25H); Recombinant Pig Cholesterol 25-hydroxylase (CH25H); CH25H recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-270aa; full length protein
Sequence
MSGHNNSELFVLCSSSQLFLQPLWDHLKTWETLILSPFFPVFFSITTYLGFCLPFVVLDV LCPWVPALRRYKIHPDFSPSVWQLLPCLGLTLYQHVVFVFPMTLLHWAASPVLLPPEAPE LLQLVRHIVLCLLLFDTEFFIWHVLHHKVPWLYRTFHKMHHQNSSSFALATQYMSVGELL SLGVFDMVNIMLLRCHPLTVLIFHVINIWLSVEDHSGYDFPWSAHRLVPFGWYGGVTHHD LHHSQFNCNFAPYFTHWDKILGTLRSAHAK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Pig
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for CH25H recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
31,482 Da
NCBI Official Full Name
Cholesterol 25-hydroxylase
NCBI Official Symbol
CH25H
NCBI Protein Information
cholesterol 25-hydroxylase; Cholesterol 25-monooxygenase
UniProt Protein Name
Cholesterol 25-hydroxylase
Protein Family
UniProt Gene Name
CH25H
UniProt Entry Name
CH25H_PIG
Uniprot Description
Catalyzes the formation of 25-hydroxycholesterol from cholesterol, leading to repress cholesterol biosynthetic enzymes. Plays a key role in cell positioning and movement in lymphoid tissues: 25-hydroxycholesterol is an intermediate in biosynthesis of 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC), an oxysterol that acts as a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for a number of lymphoid cells. May play an important role in regulating lipid metabolism by synthesizing a corepressor that blocks sterol regulatory element binding protein (SREBP) processing. In testis, production of 25-hydroxycholesterol by macrophages may play a role in Leydig cell differentiation.
Similar Products
Product Notes
The CH25H ch25h (Catalog #AAA7011403) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-270aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the CH25H ch25h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGHNNSELF VLCSSSQLFL QPLWDHLKTW ETLILSPFFP VFFSITTYLG FCLPFVVLDV LCPWVPALRR YKIHPDFSPS VWQLLPCLGL TLYQHVVFVF PMTLLHWAAS PVLLPPEAPE LLQLVRHIVL CLLLFDTEFF IWHVLHHKVP WLYRTFHKMH HQNSSSFALA TQYMSVGELL SLGVFDMVNI MLLRCHPLTV LIFHVINIWL SVEDHSGYDF PWSAHRLVPF GWYGGVTHHD LHHSQFNCNF APYFTHWDKI LGTLRSAHAK. It is sometimes possible for the material contained within the vial of "Cholesterol 25-hydroxylase (CH25H), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
