Centrin-2 Recombinant Protein | CETN2 recombinant protein

Recombinant Human Centrin-2

Cat. Num. AAA953315

• Gene Names: CETN2; CALT; CEN2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Centrin-2; Recombinant Human Centrin-2; Caltractin isoform 1; CETN2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-172aa; Full Length
• Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
• Sequence Length: 172

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CETN2 recombinant protein

Plays a fundamental role in microtubule organizing center structure and function. Required for centriole duplication and correct spindle formation. Has a role in regulating cytokinesis and genome stability via cooperation with CALM1 and CCP110. Involved in global genome nucleotide excision repair (GG-NER) by acting as component of the XPC complex. Cooperatively with RAD23B appears to stabilize XPC. In vitro, stimulates DNA binding of the XPC:RAD23B dimer. The XPC complex is proposed to represent the first factor bound at the sites of DNA damage and together with other core recognition factors, XPA, RPA and the TFIIH complex, is part of the pre-incision (or initial recognition) complex. The XPC complex recognizes a wide spectrum of damaged DNA characterized by distortions of the DNA helix such as single-stranded loops, mismatched bubbles or single-stranded overhangs. The orientation of XPC complex binding appears to be crucial for inducing a productive NER. XPC complex is proposed to recognize and to interact with unpaired bases on the undamaged DNA strand which is followed by recruitment of the TFIIH complex and subsequent scanning for lesions in the opposite strand in a 5'-to-3' direction by the NER machinery. Cyclobutane pyrimidine dimers (CPDs) which are formed upon UV-induced DNA damage esacpe detection by the XPC complex due to a low degree of structural perurbation. Instead they are detected by the UV-DDB complex which in turn recruits and cooperates with the XPC complex in the respective DNA repair. Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, DSS1, and either centrin CETN2 or CETN3. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery.

Product Categories/Family for CETN2 recombinant protein

Cell Cycle

References

Molecular cloning and centrosomal localization of human caltractin.Lee V.D., Huang B.Proc. Natl. Acad. Sci. U.S.A. 90:11039-11043(1993)

NCBI and Uniprot Product Information

• NCBI GI #: 4757902
• NCBI GeneID: 1069
• NCBI Accession #: NP_004335.1
• NCBI GenBank Nucleotide #: NM_004344.1
• UniProt Accession #: P41208; Q53XW1; B2R4T4
• Molecular Weight: 35.7 kDa
• NCBI Official Full Name: centrin-2
• NCBI Official Synonym Full Names: centrin 2
• NCBI Official Symbol: CETN2
• NCBI Official Synonym Symbols: CALT; CEN2
• NCBI Protein Information: centrin-2
• UniProt Protein Name: Centrin-2
• Protein Family: Centrin
• UniProt Gene Name: CETN2
• UniProt Synonym Gene Names: CALT; CEN2
• UniProt Entry Name: CETN2_HUMAN

NCBI Description

Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome. [provided by RefSeq, Jul 2008]

Uniprot Description

CETN2: a calcium-binding proteins and is a structural component of the centrosome. Contains 4 EF-hand calcium-binding domains. Highly conserved from algae to humans. Its association with the centrosome suggests that it plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.

Protein type: Calcium-binding; Cell cycle regulation; DNA repair, damage

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: centriole; centrosome; cytosol; intracellular; nucleoplasm; photoreceptor connecting cilium

Molecular Function: calcium ion binding; G-protein beta/gamma-subunit binding; heterotrimeric G-protein binding; microtubule binding; protein binding

Biological Process: cell division; cellular protein metabolic process; centriole replication; DNA repair; G2/M transition of mitotic cell cycle; mitosis; mitotic cell cycle; nucleotide-excision repair; nucleotide-excision repair, DNA damage recognition; organelle organization and biogenesis; post-translational protein modification; protein sumoylation; regulation of cytokinesis; spermatogenesis