Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Centrin-1 (CETN1) Recombinant Protein | CETN1 recombinant protein

Recombinant Human Centrin-1 (CETN1)

Gene Names
CETN1; CEN1; CETN
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Centrin-1 (CETN1); Recombinant Human Centrin-1 (CETN1); Centrin-1; Caltractin isoform 2; CETN1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-172aa; Full Length
Sequence
MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY
Sequence Length
172
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for CETN1 recombinant protein
Plays a fundamental role in microtubule-organizing center structure and function.
Product Categories/Family for CETN1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46.6 kDa
NCBI Official Full Name
centrin-1
NCBI Official Synonym Full Names
centrin, EF-hand protein, 1
NCBI Official Symbol
CETN1
NCBI Official Synonym Symbols
CEN1; CETN
NCBI Protein Information
centrin-1; caltractin; EF-hand protein; calcium binding protein
UniProt Protein Name
Centrin-1
Protein Family
UniProt Gene Name
CETN1
UniProt Synonym Gene Names
CEN1; CETN
UniProt Entry Name
CETN1_HUMAN

NCBI Description

The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq, Jul 2008]

Uniprot Description

CETN1: Plays a fundamental role in microtubule-organizing center structure and function. Belongs to the centrin family.

Chromosomal Location of Human Ortholog: 18p11.32

Cellular Component: centriole; spindle pole; centrosome; photoreceptor connecting cilium

Molecular Function: protein binding; microtubule binding; G-protein beta/gamma-subunit binding; calcium ion binding; heterotrimeric G-protein binding

Biological Process: mitosis; cell division

Research Articles on CETN1

Similar Products

Product Notes

The CETN1 cetn1 (Catalog #AAA1344739) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-172aa; Full Length. The amino acid sequence is listed below: MASGFKKPSA ASTGQKRKVA PKPELTEDQK QEVREAFDLF DVDGSGTIDA KELKVAMRAL GFEPRKEEMK KMISEVDREG TGKISFNDFL AVMTQKMSEK DTKEEILKAF RLFDDDETGK ISFKNLKRVA NELGENLTDE ELQEMIDEAD RDGDGEVNEE EFLRIMKKTS LY. It is sometimes possible for the material contained within the vial of "Centrin-1 (CETN1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.