Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CUGBP Elav-like family member 1 (CELF1) Recombinant Protein | CELF1 recombinant protein

Recombinant Human CUGBP Elav-like family member 1 (CELF1) (T173E, S178D, S285D, S288D, S295D, S296D, S298D)

Gene Names
CELF1; CUGBP; NAB50; NAPOR; CUG-BP; CUGBP1; hNab50; BRUNOL2; EDEN-BP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CUGBP Elav-like family member 1 (CELF1); Recombinant Human CUGBP Elav-like family member 1 (CELF1) (T173E; S178D; S285D; S288D; S295D; S296D; S298D); CELF-1; 50 kDa nuclear polyadenylated RNA-binding protein; Bruno-like protein 2; CUG triplet repeat RNA-binding protein 1; CUG-BP1; CUG-BP- and ETR-3-like factor 1; Deadenylation factor CUG-BP; Embryo deadenylation element-binding protein homolog; EDEN-BP homolog; RNA-binding protein BRUNOL-2; CELF1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
Sequence Positions
1-482aa, Full Length
Sequence
MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRMLRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQEMEGCDSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSDPLDVLTSSGDDPDSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY
Species
Human
Tag
Tag-Free
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Product Categories/Family for CELF1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,063 Da
NCBI Official Full Name
CUGBP Elav-like family member 1 isoform 3
NCBI Official Synonym Full Names
CUGBP, Elav-like family member 1
NCBI Official Symbol
CELF1
NCBI Official Synonym Symbols
CUGBP; NAB50; NAPOR; CUG-BP; CUGBP1; hNab50; BRUNOL2; EDEN-BP
NCBI Protein Information
CUGBP Elav-like family member 1; CELF-1; CUG-BP1; bruno-like 2; EDEN-BP homolog; bruno-like protein 2; CUG RNA-binding protein; deadenylation factor CUG-BP; RNA-binding protein BRUNOL-2; CUG-BP- and ETR-3-like factor 1; CUG triplet repeat RNA-binding prot
UniProt Protein Name
CUGBP Elav-like family member 1
Protein Family
UniProt Gene Name
CELF1
UniProt Synonym Gene Names
BRUNOL2; CUGBP; CUGBP1; NAB50; CELF-1; CUG-BP1
UniProt Entry Name
CELF1_HUMAN

NCBI Description

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

CELF1: RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre- mRNAs. Activates SM exon 5 inclusion by antagonizing the repressive effect of PTB. Promotes exclusion of exon 11 of the INSR pre-mRNA. Inhibits, together with HNRNPH1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Increases translation and controls the choice of translation initiation codon of CEBPB mRNA. Increases mRNA translation of CEBPB in aging liver. Increases translation of CDKN1A mRNA by antagonizing the repressive effect of CALR3. Mediates rapid cytoplasmic mRNA deadenylation. Recruits the deadenylase PARN to the poly(A) tail of EDEN-containing mRNAs to promote their deadenylation. Required for completion of spermatogenesis. Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK and to Bruno response elements (BREs). Binds to muscle-specific splicing enhancer (MSE) intronic sites flanking the alternative exon 5 of TNNT2 pre-mRNA. Binds to AU-rich sequences (AREs or EDEN-like) localized in the 3'-UTR of JUN and FOS mRNAs. Binds to the IR RNA. Binds to the 5'-region of CDKN1A and CEBPB mRNAs. Binds with the 5'-region of CEBPB mRNA in aging liver. Belongs to the CELF/BRUNOL family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: 11p11

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleus; ribonucleoprotein complex

Molecular Function: mRNA binding; protein binding; translation initiation factor binding; RNA binding; translation repressor activity, nucleic acid binding; BRE binding; nucleotide binding

Biological Process: mRNA splice site selection; embryonic development; regulation of RNA splicing; negative regulation of translation; positive regulation of multicellular organism growth; mRNA processing; spermatid development; germ cell development; RNA interference

Research Articles on CELF1

Similar Products

Product Notes

The CELF1 celf1 (Catalog #AAA7137037) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-482aa, Full Length. The amino acid sequence is listed below: MNGTLDHPDQ PDLDAIKMFV GQVPRTWSEK DLRELFEQYG AVYEINVLRD RSQNPPQSKG CCFVTFYTRK AALEAQNALH NMKVLPGMHH PIQMKPADSE KNNAVEDRKL FIGMISKKCT ENDIRVMFSS FGQIEECRML RGPDGLSRGC AFVTFTTRAM AQTAIKAMHQ AQEMEGCDSP MVVKFADTQK DKEQKRMAQQ LQQQMQQISA ASVWGNLAGL NTLGPQYLAL LQQTASSGNL NTLSSLHPMG GLNAMQLQNL AALAAAASAA QNTPSGTNAL TTSSDPLDVL TSSGDDPDSS SSNSVNPIAS LGALQTLAGA TAGLNVGSLA GMAALNGGLG SSGLSNGTGS TMEALTQAYS GIQQYAAAAL PTLYNQNLLT QQSIGAAGSQ KEGPEGANLF IYHLPQEFGD QDLLQMFMPF GNVVSAKVFI DKQTNLSKCF GFVSYDNPVS AQAAIQSMNG FQIGMKRLKV QLKRSKNDSK PY. It is sometimes possible for the material contained within the vial of "CUGBP Elav-like family member 1 (CELF1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.