Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cyclin-dependent kinase inhibitor 2A, isoform 2 (Cdkn2a) Recombinant Protein | Cdkn2a recombinant protein

Recombinant Rat Cyclin-dependent kinase inhibitor 2A, isoform 2 (Cdkn2a)

Gene Names
Cdkn2a; Arf; p16; MTS1; INK4A; p19ARF; p16Cdkn2a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-dependent kinase inhibitor 2A; isoform 2 (Cdkn2a); Recombinant Rat Cyclin-dependent kinase inhibitor 2A; Cdkn2a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-160, full length protein
Sequence
MGRRFVVTVRIRRTGRSPQVRVFLVQFLGSSRPRSANGTRGFVALVLRPERIARRGPQPHPGPGDDDGQRQSGSSPALLWCRFELRGPHHPLPTGARRSAGGLPRHSGSTAPGRGAAGCARCLGSPAARPGPRAGTSRRRAVFAVSTLLRWERFPGHRQA
Sequence Length
160
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cdkn2a recombinant protein
This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, MDM1, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
17,366 Da
NCBI Official Full Name
Tumor suppressor ARF
NCBI Official Synonym Full Names
cyclin-dependent kinase inhibitor 2A
NCBI Official Symbol
Cdkn2a
NCBI Official Synonym Symbols
Arf; p16; MTS1; INK4A; p19ARF; p16Cdkn2a
NCBI Protein Information
cyclin-dependent kinase inhibitor 2A
UniProt Protein Name
Tumor suppressor ARF
UniProt Gene Name
Cdkn2a
UniProt Synonym Gene Names
ARF

NCBI Description

tumor suppressor that inhibits CDK4; inactivation or loss is associated with cellular transformation; may be involved in CNS degeneration following injury [RGD, Feb 2006]

Uniprot Description

Capable of inducing cell cycle arrest in G1 and G2 phases. Acts as a tumor suppressor. Binds to MDM2 and blocks its nucleocytoplasmic shuttling by sequestering it in the nucleolus. This inhibits the oncogenic action of MDM2 by blocking MDM2-induced degradation of p53 and enhancing p53-dependent transactivation and apoptosis. Also induces G2 arrest and apoptosis in a p53-independent manner by preventing the activation of cyclin B1/CDC2 complexes. Binds to BCL6 and down-regulates BCL6-induced transcriptional repression. Binds to E2F1 and MYC and blocks their transcriptional activator activity but has no effect on MYC transcriptional repression. Binds to TOP1/TOPOI and stimulates its activity. This complex binds to rRNA gene promoters and may play a role in rRNA transcription and/or maturation. Interacts with NPM1/B23 and promotes its polyubiquitination and degradation, thus inhibiting rRNA processing. Interacts with COMMD1 and promotes its 'Lys63'-linked polyubiquitination. Interacts with UBE2I/UBC9 and enhances sumoylation of a number of its binding partners including MDM2 and E2F1. Binds to HUWE1 and represses its ubiquitin ligase activity. May play a role in controlling cell proliferation and apoptosis during mammary gland development ().

Research Articles on Cdkn2a

Similar Products

Product Notes

The Cdkn2a cdkn2a (Catalog #AAA1326747) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-160, full length protein. The amino acid sequence is listed below: MGRRFVVTVR IRRTGRSPQV RVFLVQFLGS SRPRSANGTR GFVALVLRPE RIARRGPQPH PGPGDDDGQR QSGSSPALLW CRFELRGPHH PLPTGARRSA GGLPRHSGST APGRGAAGCA RCLGSPAARP GPRAGTSRRR AVFAVSTLLR WERFPGHRQA. It is sometimes possible for the material contained within the vial of "Cyclin-dependent kinase inhibitor 2A, isoform 2 (Cdkn2a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.