Cyclin-dependent kinase 20 (CDK20) Recombinant Protein | CDK20 recombinant protein
Recombinant Human Cyclin-dependent kinase 20 (CDK20)
Gene Names
CDK20; P42; CCRK; CDCH; PNQALRE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-dependent kinase 20 (CDK20); Recombinant Human Cyclin-dependent kinase 20 (CDK20); CDK20 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-346, Full length protein
Sequence
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG
Sequence Length
346
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CDK20 recombinant protein
This protein contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,113 Da
NCBI Official Full Name
cyclin-dependent kinase 20 isoform 3
NCBI Official Synonym Full Names
cyclin dependent kinase 20
NCBI Official Symbol
CDK20
NCBI Official Synonym Symbols
P42; CCRK; CDCH; PNQALRE
NCBI Protein Information
cyclin-dependent kinase 20
UniProt Protein Name
Cyclin-dependent kinase 20
Protein Family
UniProt Gene Name
CDK20
UniProt Synonym Gene Names
CCRK; CDCH; CAK-kinase p42
NCBI Description
The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Dec 2009]
Uniprot Description
Required for high-level Shh responses in the developing neural tube. Together with TBC1D32, controls the structure of the primary cilium by coordinating assembly of the ciliary membrane and axoneme, allowing GLI2 to be properly activated in response to SHH signaling (). Involved in cell growth. Activates CDK2, a kinase involved in the control of the cell cycle, by phosphorylating residue 'Thr-160'.
Research Articles on CDK20
Similar Products
Product Notes
The CDK20 cdk20 (Catalog #AAA1340078) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-346, Full length protein. The amino acid sequence is listed below: MDQYCILGRI GEGAHGIVFK AKHVETGEIV ALKKVALRRL EDGFPNQALR EIKALQEMED NQYVVQLKAV FPHGGGFVLA FEFMLSDLAE VVRHAQRPLA QAQVKSYLQM LLKGVAFCHA NNIVHRDLKP ANLLISASGQ LKIADFGLAR VFSPDGSRLY THQVATRWYR APELLYGARQ YDQGVDLWSV GCIMGELLNG SPLFPGKNDI EQLCYVLRIL GTPNPQVWPE LTELPDYNKI SFKEQVPMPL EEVLPDVSPQ ALDLLGQFLL YPPHQRIAAS KALLHQYFFT APLPAHPSEL PIPQRLGGPA PKAHPGPPHI HDFHVDRPLE ESLLNPELIR PFILEG. It is sometimes possible for the material contained within the vial of "Cyclin-dependent kinase 20 (CDK20), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
