Dual specificity phosphatase Cdc25 (CDC25) Recombinant Protein | CDC25 recombinant protein
Recombinant Arabidopsis thaliana Dual specificity phosphatase Cdc25 (CDC25)
Gene Names
CDC25; ACR2; ARATH;CDC25; ARSENATE REDUCTASE; ARSENATE REDUCTASE 2; AtACR2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dual specificity phosphatase Cdc25 (CDC25); Recombinant Arabidopsis thaliana Dual specificity phosphatase Cdc25 (CDC25); CDC25 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-146, Full length protein
Sequence
MGRSIFSFFTKKKKMAMARSISYITSTQLLPLHRRPNIAIIDVRDEERNYDGHIAGSLHYASGSFDDKISHLVQNVKDKDTLVFHCALSQVRGPTCARRLVNYLDEKKEDTGIKNIMILERGFNGWEASGKPVCRCAEVPCKGDCA
Sequence Length
146
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,450 Da
NCBI Official Full Name
Rhodanese/Cell cycle control phosphatase superfamily protein
NCBI Official Symbol
CDC25
NCBI Official Synonym Symbols
ACR2; ARATH;CDC25; ARSENATE REDUCTASE; ARSENATE REDUCTASE 2; AtACR2
NCBI Protein Information
Rhodanese/Cell cycle control phosphatase superfamily protein
UniProt Protein Name
Dual specificity phosphatase Cdc25
Protein Family
UniProt Gene Name
CDC25
UniProt Synonym Gene Names
AtStr5
NCBI Description
Encodes a homolog of yeast cell cycle regulator CDC25. It has a sole catalytic domain and devoid of the N-terminal regulatory region found in the human CDC25 and is capable of reducing the mitotic cell length of transformed fission yeast. Non-plant CDC25 proteins have been shown to do this. However, the gene is more or less constant, regardless of whether the tissue examined contained proliferative cells. Also described as having arsenate reductase activity involved in arsenate resistance.
Uniprot Description
Tyrosine protein phosphatase that dephosphorylates CDK complex and activate its kinase activity in vitro.
Research Articles on CDC25
Similar Products
Product Notes
The CDC25 cdc25 (Catalog #AAA1438237) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-146, Full length protein. The amino acid sequence is listed below: MGRSIFSFFT KKKKMAMARS ISYITSTQLL PLHRRPNIAI IDVRDEERNY DGHIAGSLHY ASGSFDDKIS HLVQNVKDKD TLVFHCALSQ VRGPTCARRL VNYLDEKKED TGIKNIMILE RGFNGWEASG KPVCRCAEVP CKGDCA. It is sometimes possible for the material contained within the vial of "Dual specificity phosphatase Cdc25 (CDC25), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
