CD9 recombinant protein

CD9 Recombinant Protein

Cat. Num. AAA3003740

• Gene Names: CD9; MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD9; CD9 Recombinant Protein; CD9 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 264
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD9 recombinant protein

Background: The CD9 antigen belongs to the tetraspanin family of cell surface glycoproteins, and is characterized by four transmembrane domains, one short extracellular domain (ECL1), and one long extracellular domain (ECL2). Tetraspanins interact with a variety of cell surface proteins and intracellular signaling molecules in specialized tetraspanin-enriched microdomains (TEMs), where they mediate a range of processes including adhesion, motility, membrane organization, and signal transduction. Research studies demonstrate that CD9 expression on the egg is required for gamete fusion during fertilization. CD9 was also shown to play a role in dendritic cell migration, megakaryocyte differentiation, and homing of cord blood CD34+ hematopoietic progenitors to the bone marrow. In addition, down regulation of CD9 expression is associated with poor prognosis and progression of several types of cancer. Additional research identified CD9 as an abundant component of exosomes, and may play some role in the fusion of these secreted membrane vesicles with recipient cells.

NCBI and Uniprot Product Information

• NCBI GI #: 34769
• NCBI GeneID: 928
• UniProt Accession #: P21926; Q5J7W6; Q96ES4; D3DUQ9
• Molecular Weight: 25,416 Da
• NCBI Official Full Name: MRP-1 (motility related protein)
• NCBI Official Synonym Full Names: CD9 molecule
• NCBI Official Symbol: CD9
• NCBI Official Synonym Symbols: MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
• NCBI Protein Information: CD9 antigen; 5H9 antigen; tetraspanin-29; BA-2/p24 antigen; CD9 antigen (p24); leukocyte antigen MIC3; motility related protein-1; cell growth-inhibiting gene 2 protein
• UniProt Protein Name: CD9 antigen
• Protein Family: CD9 antigen
• UniProt Gene Name: CD9
• UniProt Synonym Gene Names: MIC3; TSPAN29; MRP-1; Tspan-29
• UniProt Entry Name: CD9_HUMAN

NCBI Description

This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis. [provided by RefSeq, Jan 2011]

Uniprot Description

CD9: Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion. Belongs to the tetraspanin (TM4SF) family.

Protein type: Motility/polarity/chemotaxis; Membrane protein, multi-pass; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: extracellular space; platelet alpha granule membrane; focal adhesion; integral to plasma membrane; apical plasma membrane; plasma membrane; vesicle; external side of plasma membrane

Molecular Function: integrin binding; protein binding

Biological Process: negative regulation of cell proliferation; platelet activation; platelet degranulation; fusion of sperm to egg plasma membrane; single fertilization; pathogenesis; brain development; cell adhesion; cell motility; blood coagulation; oligodendrocyte development; response to water deprivation; multicellular organism reproduction; paranodal junction assembly