Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

T-cell surface glycoprotein CD8 alpha chain (Cd8a) Recombinant Protein | Cd8a recombinant protein

Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a)

Gene Names
Cd8a; Ly-2; Ly-B; Ly-35; Lyt-2; BB154331
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
T-cell surface glycoprotein CD8 alpha chain (Cd8a); Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a); T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein Lyt-2; CD_antigen=; CD8a; Cd8a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
28-196, partial. Provide the complete extracellular domain.
Sequence
KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY
Sequence Length
196
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,456 Da
NCBI Official Full Name
T-cell surface glycoprotein CD8 alpha chain isoform 1
NCBI Official Synonym Full Names
CD8 antigen, alpha chain
NCBI Official Symbol
Cd8a
NCBI Official Synonym Symbols
Ly-2; Ly-B; Ly-35; Lyt-2; BB154331
NCBI Protein Information
T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100)
UniProt Protein Name
T-cell surface glycoprotein CD8 alpha chain
UniProt Gene Name
Cd8a
UniProt Synonym Gene Names
Lyt-2; Lyt2
UniProt Entry Name
CD8A_MOUSE

Uniprot Description

CD8A: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains. In general heterodimer of an alpha and a beta chain linked by two disulfide bonds. Can also form homodimers. Shown to be expressed as heterodimer on thymocytes and as homodimer on peripheral blood T-lymphocytes. Interacts with the MHC class I HLA-A/B2M dimer. Interacts with LCK in a zinc-dependent manner. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Cellular Component: cell surface; membrane; integral to membrane; external side of plasma membrane

Molecular Function: protein binding; protein homodimerization activity; protein kinase binding

Biological Process: cell surface receptor linked signal transduction; T cell activation; immune system process; T cell mediated immunity; positive regulation of calcium-mediated signaling; cytotoxic T cell differentiation; defense response to virus

Research Articles on Cd8a

Similar Products

Product Notes

The Cd8a cd8a (Catalog #AAA966506) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-196, partial. Provide the complete extracellular domain. The amino acid sequence is listed below: KPQAPELRIF PKKMDAELGQ KVDLVCEVLG SVSQGCSWLF QNSSSKLPQP TFVVYMASSH NKITWDEKLN SSKLFSAMRD TNNKYVLTLN KFSKENEGYY FCSVISNSVM YFSSVVPVLQ KVNSTTTKPV LRTPSPVHPT GTSQPQRPED CRPRGSVKGT GLDFACDIY . It is sometimes possible for the material contained within the vial of "T-cell surface glycoprotein CD8 alpha chain (Cd8a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.