Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD79A recombinant protein

CD79A Recombinant Protein

Gene Names
CD79A; IGA; MB-1
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD79A; CD79A Recombinant Protein; CD79A recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
345
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD79A recombinant protein
Background: Antigen receptors found on the surface of B cells contain a heterodimeric signaling component composed of CD79A and CD79B, also known as Ig alpha and Ig beta, respectively. Presence of this receptor complex is essential for B-cell development and function. Together these two proteins and the associated B cell receptor initiate intracellular signaling following antigen binding. An immunoreceptor tyrosine-based activation motif (ITAM) found in the CD79A intracellular region appears to be important for its function. Antigen binding precedes formation of the CD79A and CD79B heterodimer and subsequent activation of receptor associated kinases. Research has shown that CD79A is a marker for B-lineage lymphoblastic leukemia. Additionally, investigators have found that mutations in the CD79A (MB1) gene are associated with abnormally low levels of functional B cell receptors in some cases of chronic B cell lymphocytic leukemia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
973
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,038 Da
NCBI Official Full Name
B-cell antigen receptor complex-associated protein alpha chain isoform 1
NCBI Official Synonym Full Names
CD79a molecule, immunoglobulin-associated alpha
NCBI Official Symbol
CD79A
NCBI Official Synonym Symbols
IGA; MB-1
NCBI Protein Information
B-cell antigen receptor complex-associated protein alpha chain; ig-alpha; MB-1 membrane glycoprotein; surface IgM-associated protein; CD79a antigen (immunoglobulin-associated alpha); membrane-bound immunoglobulin-associated protein
UniProt Protein Name
B-cell antigen receptor complex-associated protein alpha chain
UniProt Gene Name
CD79A
UniProt Synonym Gene Names
IGA; MB1
UniProt Entry Name
CD79A_HUMAN

NCBI Description

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

Ig-alpha: an integral membrane protein that associates with surface immunoglobulin B lymphocyte antigen receptor multimeric complex. Surface Ig non-covalently associates with 2 other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. Two alternatively spliced isoforms have been described.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: multivesicular body; integral to membrane; plasma membrane; B cell receptor complex; lipid raft; external side of plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: B cell proliferation; B cell receptor signaling pathway; B cell activation; B cell differentiation

Disease: Agammaglobulinemia 3, Autosomal Recessive

Research Articles on CD79A

Similar Products

Product Notes

The CD79A cd79a (Catalog #AAA3003702) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: LWMHKVPASL MVSLGEDAHF QCPHNSSNNA NVTWWRVLHG NYTWPPEFLG PGEDPNGTLI IQNVNKSHGG IYVCRVQEGN ESYQQSCGTY LRVRQPPPRP FLDMGEGTKN R. It is sometimes possible for the material contained within the vial of "CD79A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.