Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CD63 antigen Recombinant Protein | CD63 recombinant protein

CD63 antigen

Gene Names
CD63; MLA1; ME491; LAMP-3; OMA81H; TSPAN30
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CD63 antigen; CD63 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-238aa; Full Length of Mature Protein
Sequence
AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CD63 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for CD63 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
967
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,271 Da
NCBI Official Full Name
CD63 antigen isoform A
NCBI Official Synonym Full Names
CD63 molecule
NCBI Official Symbol
CD63
NCBI Official Synonym Symbols
MLA1; ME491; LAMP-3; OMA81H; TSPAN30
NCBI Protein Information
CD63 antigen
UniProt Protein Name
CD63 antigen
Protein Family
UniProt Gene Name
CD63
UniProt Synonym Gene Names
MLA1; TSPAN30; LAMP-3; Tspan-30
UniProt Entry Name
CD63_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012]

Uniprot Description

CD63: This antigen is associated with early stages of melanoma tumor progression. May play a role in growth regulation. Belongs to the tetraspanin (TM4SF) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q12-q13

Cellular Component: cell surface; endosome membrane; extracellular space; integral to plasma membrane; intrinsic to plasma membrane; late endosome membrane; lysosomal membrane; plasma membrane; platelet dense granule membrane

Molecular Function: protein binding

Biological Process: cell migration; cell-matrix adhesion; pigment granule maturation; platelet degranulation; positive regulation of receptor internalization

Research Articles on CD63

Similar Products

Product Notes

The CD63 cd63 (Catalog #AAA7042473) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-238aa; Full Length of Mature Protein. The amino acid sequence is listed below: AVEGGMKCVK FLLYVLLLAF CACAVGLIAV GVGAQLVLSQ TIIQGATPGS LLPVVIIAVG VFLFLVAFVG CCGACKENYC LMITFAIFLS LIMLVEVAAA IAGYVFRDKV MSEFNNNFRQ QMENYPKNNH TASILDRMQA DFKCCGAANY TDWEKIPSMS KNRVPDSCCI NVTVGCGINF NEKAIHKEGC VEKIGGWLRK NVLVVAAAAL GIAFVEVLGI VFACCLVKSI RSGYEVM . It is sometimes possible for the material contained within the vial of "CD63 antigen, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.