CD3G recombinant protein

CD3G Recombinant Protein

Cat. Num. AAA3003608

• Gene Names: CD3G; T3G; IMD17; CD3-GAMMA
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD3G; CD3G Recombinant Protein; CD3G recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 294
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD3G recombinant protein

Background: The T cell antigen receptor (TCR) recognizes foreign antigens and translates such recognition events into intracellular signals that elicit a change in the cell from a dormant to an activated state. Much of this signaling process can be attributed to a multisubunit complex of proteins that associates directly with the TCR. This complex has been designated CD3 (cluster of differentiation 3). It is composed of five invariant polypeptide chains that associate to form three dimers: a heterodimer of gamma and epsilon chains (gammaepsilon), a heterodimer of delta and epsilon chains(deltaepsilon) and a homodimer of two zeta chains (zetazeta) or a heterodimer of zeta and eta chains (zetaeta). The zeta and eta chains are encoded by the same gene but differ in their carboxyl-terminal ends due to an alternative splicing event. The gamma, epsilon and delta chains each contain a single copy of a conserved immunoreceptor tyrosinebased activation motif (ITAM). In contrast, the zeta chain contains three consecutive copies of the same motif. Phosphorylated ITAMs act as docking sites for protein kinases such as ZAP-70 and Syk and are also capable of regulating their kinase activity. The crystal structure of the ZAP-70 SH2 domains bound to the zeta chain ITAMs has been solved.

NCBI and Uniprot Product Information

• NCBI GI #: 4557429
• NCBI GeneID: 917
• NCBI Accession #: NP_000064.1
• NCBI GenBank Nucleotide #: NM_000073.2
• UniProt Accession #: P09693; Q2HIZ6
• NCBI Official Full Name: T-cell surface glycoprotein CD3 gamma chain
• NCBI Official Synonym Full Names: CD3g molecule, gamma (CD3-TCR complex)
• NCBI Official Symbol: CD3G
• NCBI Official Synonym Symbols: T3G; IMD17; CD3-GAMMA
• NCBI Protein Information: T-cell surface glycoprotein CD3 gamma chain; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule, epsilon (CD3-TCR complex); T-cell antigen receptor complex, gamma subunit of T3; T-cell receptor T3 gamma chain
• UniProt Protein Name: T-cell surface glycoprotein CD3 gamma chain
• Protein Family: T-cell surface glycoprotein
• UniProt Gene Name: CD3G
• UniProt Synonym Gene Names: T3G
• UniProt Entry Name: CD3G_HUMAN

NCBI Description

The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. [provided by RefSeq, Jul 2008]

Uniprot Description

CD3G: The CD3 complex mediates signal transduction.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: T cell receptor complex; integral to plasma membrane; plasma membrane; alpha-beta T cell receptor complex

Molecular Function: receptor signaling complex scaffold activity; transmembrane receptor activity; protein heterodimerization activity; T cell receptor binding

Biological Process: protein transport; regulation of immune response; cell surface receptor linked signal transduction; T cell activation; T cell costimulation; establishment and/or maintenance of cell polarity; innate immune response; protein complex assembly; T cell receptor signaling pathway

Disease: Immunodeficiency 17