Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD3E recombinant protein

CD3E Recombinant Protein

Gene Names
CD3E; T3E; TCRE; IMD18
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD3E; CD3E Recombinant Protein; CD3E recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
324
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD3E recombinant protein
Background: When T cells encounter antigens via the T cell receptor (TCR), information about the quantity and quality of antigens is relayed to the intracellular signal transduction machinery. This activation process depends mainly on CD3 (Cluster of Differentiation 3), a multiunit protein complex that directly associates with the TCR. CD3 is composed of four polypeptides: zeta, gamma, epsilon and delta. Each of these polypeptides contains at least one immunoreceptor tyrosine-based activation motif (ITAM). Engagement of TCR complex with foreign antigens induces tyrosine phosphorylation in the ITAM motifs and phosphorylated ITAMs function as docking sites for signaling molecules such as ZAP-70 and p85 subunit of PI-3 kinase. TCR ligation also induces a conformational change in CD3epsilon, such that a proline region is exposed and then associates with the adaptor protein Nck.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
916
UniProt Accession #
Molecular Weight
207
NCBI Official Full Name
T-cell surface glycoprotein CD3 epsilon chain
NCBI Official Synonym Full Names
CD3e molecule, epsilon (CD3-TCR complex)
NCBI Official Symbol
CD3E
NCBI Official Synonym Symbols
T3E; TCRE; IMD18
NCBI Protein Information
T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon; T-cell surface antigen T3/Leu-4 epsilon chain; CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell antigen receptor complex, epsilon subunit of T3
UniProt Protein Name
T-cell surface glycoprotein CD3 epsilon chain
UniProt Gene Name
CD3E
UniProt Synonym Gene Names
T3E
UniProt Entry Name
CD3E_HUMAN

NCBI Description

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq, Jul 2008]

Uniprot Description

CD3E: a T cell surface glycoprotein that is a component of the T cell antigen receptor. The recruitment of Nck by CD3 epsilon reveals a ligand-induced conformational change essential for T cell receptor signaling and synapse formation. Contains 1 immunoglobulin-like domain and 1 ITAM domain.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q23

Cellular Component: T cell receptor complex; integral to plasma membrane; plasma membrane; immunological synapse; alpha-beta T cell receptor complex; intercellular junction; external side of plasma membrane

Molecular Function: protein binding; transmembrane receptor activity; receptor signaling complex scaffold activity; protein heterodimerization activity; receptor signaling protein activity; T cell receptor binding; SH3 domain binding; protein kinase binding

Biological Process: regulation of immune response; T cell activation; positive regulation of interleukin-2 biosynthetic process; signal complex assembly; positive regulation of calcium-mediated signaling; negative thymic T cell selection; T cell receptor signaling pathway; positive regulation of interleukin-4 production; regulation of apoptosis; G-protein coupled receptor protein signaling pathway; positive regulation of interferon-gamma production; positive regulation of peptidyl-tyrosine phosphorylation; cell surface receptor linked signal transduction; negative regulation of smoothened signaling pathway; T cell costimulation; protein complex assembly; positive regulation of alpha-beta T cell proliferation; positive regulation of T cell proliferation; positive regulation of T cell anergy; transmembrane receptor protein tyrosine kinase signaling pathway; response to nutrient

Disease: Immunodeficiency 18

Research Articles on CD3E

Similar Products

Product Notes

The CD3E cd3e (Catalog #AAA3003607) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DGNEEMGGIT QTPYKVSISG TTVILTCPQY PGSEILWQHN DKNIGGDEDD KNIGSDEDHL SLKEFSELEQ SGYYVCYPRG SKPEDANFYL YLRARVCENC MEMD. It is sometimes possible for the material contained within the vial of "CD3E, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.