CD34 recombinant protein
Human CD34, soluble
Protein Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNE ATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPE TTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIR EVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSL LLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVA SHQSYSQKTLEHHHHHH
NCBI and Uniprot Product Information
NCBI Description
The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]
Uniprot Description
CD34: Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins. Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues. Belongs to the CD34 family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Cell surface
Chromosomal Location of Human Ortholog: 1q32
Cellular Component: intercellular bridge; perinuclear region of cytoplasm; lysosome; integral to plasma membrane; cytoplasm; apical plasma membrane; basal plasma membrane; plasma membrane; external side of plasma membrane
Molecular Function: sulfate binding; carbohydrate binding; transcription factor binding
Biological Process: positive regulation of odontogenesis; regulation of immune response; negative regulation of nitric oxide biosynthetic process; glomerular filtration; cell motility involved in cell locomotion; negative regulation of blood coagulation; negative regulation of tumor necrosis factor production; signal transduction; positive regulation of interleukin-10 production; cell proliferation; cell-cell adhesion; positive regulation of angiogenesis; regulation of blood pressure; endothelial cell proliferation; tissue homeostasis; hemopoiesis; leukocyte migration
Research Articles on CD34
Similar Products
Product Notes
The CD34 cd34 (Catalog #AAA692218) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human CD34, soluble reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: N-Terminal Sequence: SLDNN P rotein Sequence: SLDNNGTATP ELPTQGTFSN VSTNVSYQET TTPSTLGSTS LHPVSQHGNE ATTNITETTV KFTSTSVITS VYGNTNSSVQ SQTSVISTVF TTPANVSTPE TTLKPSLSPG NVSDLSTTST SLATSPTKPY TSSSPILSDI KAEIKCSGIR EVKLTQGICL EQNKTSSCAE FKKDRGEGLA RVLCGEEQAD ADAGAQVCSL LLAQSEVRPQ CLLLVLANRT EISSKLQLMK KHQSDLKKLG ILDFTEQDVA SHQSYSQKTL EHHHHHH. It is sometimes possible for the material contained within the vial of "CD34, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
