CMRF35-like molecule 1 Recombinant Protein | CD300LF recombinant protein

Recombinant Human CMRF35-like molecule 1

Cat. Num. AAA1306423

• Gene Names: CD300LF; CLM1; NKIR; CLM-1; IREM1; LMIR3; CD300f; IREM-1; IgSF13
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: CMRF35-like molecule 1; Recombinant Human CMRF35-like molecule 1; CD300 antigen-like family member F; Immune receptor expressed on myeloid cells 1; IREM-1; Immunoglobulin superfamily member 13; IgSF13; NK inhibitory receptor; CD_antigen: CD300f; CD300LF recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 20-156aa; Extracellular Domain
• Sequence: TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
• Sequence Length: 194

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CD300LF recombinant protein

Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation.

Product Categories/Family for CD300LF recombinant protein

Immunology

References

IgSF13, a novel human inhibitory receptor of the immunoglobulin superfamily, is preferentially expressed in dendritic cells and monocytes.Sui L., Li N., Liu Q., Zhang W., Wan T., Wang B., Luo K., Sun H., Cao X.Biochem. Biophys. Res. Commun. 319:920-928(2004) IREM-1 is a novel inhibitory receptor expressed by myeloid cells.Alvarez-Errico D., Aguilar H., Kitzig F., Brckalo T., Sayos J., Lopez-Botet M.Eur. J. Immunol. 34:3690-3701(2004) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Lin L., Nong W., Zhou G., Ke R., Shen C., Zhong G., Zheng Z., Liang M., Tang Z., Wen S., Li H., Yang S.DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006) Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) The crystal structure of the extracellular domain of the inhibitor receptor expressed on myeloid cells IREM-1.Marquez J.A., Galfre E., Dupeux F., Flot D., Moran O., Dimasi N.J. Mol. Biol. 367:310-318(2007)

NCBI and Uniprot Product Information

• NCBI GI #: 574277434
• NCBI GeneID: 146722
• NCBI Accession #: NP_001276011.1
• NCBI GenBank Nucleotide #: NM_001289082.1
• UniProt Accession #: Q8TDQ1; Q3Y6P0; Q6UX24; Q7Z6A6; Q7Z7I4; Q7Z7I5; Q8N6D0; Q8NAF5; B2RCL2; C9JDN3
• Molecular Weight: 17.5 kDa
• NCBI Official Full Name: CMRF35-like molecule 1 isoform 2
• NCBI Official Synonym Full Names: CD300 molecule like family member f
• NCBI Official Symbol: CD300LF
• NCBI Official Synonym Symbols: CLM1; NKIR; CLM-1; IREM1; LMIR3; CD300f; IREM-1; IgSF13
• NCBI Protein Information: CMRF35-like molecule 1
• UniProt Protein Name: CMRF35-like molecule 1
• Protein Family: CMRF35-like molecule
• UniProt Gene Name: CD300LF
• UniProt Synonym Gene Names: CD300F; CLM1; IGSF13; IREM1; NKIR; CLM-1; IREM-1; IgSF13
• UniProt Entry Name: CLM1_HUMAN

NCBI Description

This gene encodes a member of the CD300 protein family. Members of this family are cell surface glycoproteins with a single IgV-like extracellular domain, and are involved in the regulation of immune response. The encoded protein is an inhibitory receptor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

IREM-1: Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation. Belongs to the CD300 family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: integral to membrane; plasma membrane

Biological Process: immune system process; regulation of immune response