CMRF35-like molecule 7 Recombinant Protein | CD300LB recombinant protein

Recombinant Human CMRF35-like molecule 7 (CD300LB), partial

Cat. Num. AAA9018650

• Gene Names: CD300LB; CLM7; CLM-7; IREM3; TREM5; CD300b; IREM-3; TREM-5; CMRF35-A2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: CMRF35-like molecule 7; Recombinant Human CMRF35-like molecule 7 (CD300LB); partial; CLM-7 (CD300 antigen-like family member B)(CMRF35-A2)(Immune receptor expressed on myeloid cells 3)(IREM-3)(Leukocyte mono-Ig-like receptor 5)(Triggering receptor expressed on myeloid cells 5)(TREM-5); CD300LB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 18-151aa, Partial
• Sequence: IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

• Species: Homo sapiens (Human)
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for CD300LB recombinant protein

CD300LB

NCBI and Uniprot Product Information

• NCBI GI #: 510936990
• NCBI GeneID: 124599
• NCBI Accession #: NP_777552.3
• NCBI GenBank Nucleotide #: NM_174892.3
• UniProt Accession #: A8K4G0; Q1EG73; Q8IX40; Q8N6D1
• Molecular Weight: 22,689 Da
• NCBI Official Full Name: CMRF35-like molecule 7
• NCBI Official Synonym Full Names: CD300 molecule-like family member b
• NCBI Official Symbol: CD300LB
• NCBI Official Synonym Symbols: CLM7; CLM-7; IREM3; TREM5; CD300b; IREM-3; TREM-5; CMRF35-A2
• NCBI Protein Information: CMRF35-like molecule 7; leukocyte mono-Ig-like receptor 5; CD300 antigen like family member B; immune receptor expressed on myeloid cells 3; triggering receptor expressed on myeloid cells 5
• UniProt Protein Name: CMRF35-like molecule 7
• Protein Family: CMRF35-like molecule
• UniProt Gene Name: CD300LB
• UniProt Synonym Gene Names: CD300B; CLM7; CMRF35A2; IREM3; LMIR5; TREM5; CLM-7; IREM-3; TREM-5
• UniProt Entry Name: CLM7_HUMAN

NCBI Description

CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells (Martinez-Barriocanal and Sayos, 2006 [PubMed 16920917]).[supplied by OMIM, Mar 2008]

Uniprot Description

Function: Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2. Ref.1 Ref.9

Subunit structure: Interacts with TYROBP, which enhances cell surface expression and activation properties. Interacts with GRB2 in the presence of FYN. Ref.1 Ref.9

Subcellular location: Cell membrane; Single-pass type I membrane protein

By similarity.

Tissue specificity: Expressed exclusively in myeloid lineages. Ref.1

Post-translational modification: Phosphorylation on Tyr-188 by FYN is required for interaction with GRB2.

Sequence similarities: Belongs to the CD300 family.Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Sequence caution: The sequence AAH28091.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence BAF83614.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.The sequence EAW89170.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.