Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data ()

CD209 recombinant protein

CD209 Recombinant Protein

Gene Names
CD209; CDSIGN; CLEC4L; DC-SIGN; DC-SIGN1
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD209; CD209 Recombinant Protein; CD209 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
1050
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Testing Data ()
Related Product Information for CD209 recombinant protein
Background: DC-SIGN (CD209, CLEC4L) is a C-type lectin receptor expressed by dendritic cells (DCs). The DC-SIGN transcript can undergo several splicing events to generate at least thirteen different transmembrane and soluble isoforms. DC-SIGN responds to a broad range of pathogens due to its ability to recognize both mannose and fructose carbohydrates, and is well studied for its role in HIV infection. Recognition of the HIV envelope glycoprotein gp120 by DC-SIGN leads to internalization of HIV by DCs and facilitates transmission of the virus to CD4+ T cells. DC-SIGN also mediates adhesion to T cells through interaction with ICAM-3, as well as transmigration across the endothelium by binding to ICAM-2. The DC-SIGN receptor can modulate TLR signaling by activating the kinase Raf-1. The closely related molecule DC-SIGNR (L-SIGN, CLEC4M) is 77% homologous to DC-SIGN and likely arose through a gene duplication event. Like DC-SIGN, DC-SIGNR binds mannose carbohydrates on the surface of pathogens. However, the expression patterns of the two receptors differ, as DC-SIGNR expression is restricted to endothelial cells of the liver, lymph node, and placenta. Murine cells contain a set of related molecules, SIGNR1-SIGNR8. Based on sequence analysis, there is no clear murine ortholog to human DC-SIGN, however SIGNR3 is the most functionally similar due to its ability to recognize both mannose and fructose structures.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
45,775 Da
NCBI Official Full Name
DC-SIGN
NCBI Official Synonym Full Names
CD209 molecule
NCBI Official Symbol
CD209
NCBI Official Synonym Symbols
CDSIGN; CLEC4L; DC-SIGN; DC-SIGN1
NCBI Protein Information
CD209 antigen; HIV gpl20-binding protein; C-type lectin domain family 4 member L; C-type lectin domain family 4, member L; dendritic cell-specific ICAM-3-grabbing non-integrin 1; dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing n
UniProt Protein Name
CD209 antigen
Protein Family
UniProt Gene Name
CD209
UniProt Synonym Gene Names
CLEC4L; DC-SIGN; DC-SIGN1
UniProt Entry Name
CD209_HUMAN

NCBI Description

This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.[provided by RefSeq, Feb 2009]

Uniprot Description

CD209: Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response. Probably recognizes in a calcium-dependent manner high mannose N-linked oligosaccharides in a variety of pathogen antigens, including HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus glycoproteins, cytomegalovirus gB, HCV E2, dengue virus gE, Leishmania pifanoi LPG, Lewis-x antigen in Helicobacter pylori LPS, mannose in Klebsiella pneumonae LPS, di-mannose and tri- mannose in Mycobacterium tuberculosis ManLAM and Lewis-x antigen in Schistosoma mansoni SEA. Homotetramer. Binds to many viral surface glycoproteins such as HIV-1 gp120, HIV-2 gp120, SIV gp120, ebolavirus envelope glycoproteins, cytomegalovirus gB, HCV E2 and dengue virus major envelope protein E. Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes. 13 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13

Cellular Component: cell surface; membrane; cytoplasm; integral to membrane; plasma membrane

Molecular Function: mannose binding; protein binding; peptide antigen binding; metal ion binding; virion binding; carbohydrate binding

Biological Process: cell-cell recognition; heterophilic cell adhesion; antigen processing and presentation; leukocyte adhesion; virus-host interaction; regulation of T cell proliferation; innate immune response; peptide antigen transport; endocytosis; viral genome replication; virion attachment to host cell surface receptor

Disease: Mycobacterium Tuberculosis, Susceptibility To; Human Immunodeficiency Virus Type 1, Susceptibility To

Research Articles on CD209

Similar Products

Product Notes

The CD209 cd209 (Catalog #AAA3003529) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QVSKVPSSIS QEQSRQDAIY QNLTQLKAAV GELSEKSKLQ EIYQELTQLK AAVGELPEKS KLQEIYQELT RLKAAVGELP EKSKLQEIYQ ELTWLKAAVG ELPEKSKMQE IYQELTRLKA AVGELPEKSK QQEIYQELTR LKAAVGELPE KSKQQEIYQE LTRLKAAVGE LPEKSKQQEI YQELTQLKAA VERLCHPCPW EWTFFQGNCY FMSNSQRNWH DSITACKEVG AQLVVIKSAE EQNFLQLQSS RSNRFTWMGL SDLNQEGTWQ WVDGSPLLPS FKQYWNRGEP NNVGEEDCAE FSGNGWNDDK CNLAKFWICK KSAASCSRDE EQFLSPAPAT PNPPPA. It is sometimes possible for the material contained within the vial of "CD209, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.