Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

OX-2 membrane glycoprotein Recombinant Protein | Cd200 recombinant protein

OX-2 membrane glycoprotein

Gene Names
Cd200; Mox2; Cspmo2; MRCOX2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
OX-2 membrane glycoprotein; Cd200 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
31-278aa; full length protein
Sequence
QVEVVTQDERKLLHTTASLRCSLKTTQEPLIVTWQKKKAVGPENMVTYSKAHGVVIQPTYKDRINITELGLLNTSITFWNTTLDDEGCYMCLFNMFGSGKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGSGIENSTESHSHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKGFWFSVPLLLSIVSLVILLVLISILLYWKRHRNQERGESSQGMQRMK
Sequence Length
Full Length Protein
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Cd200 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Cd200 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
31,088 Da
NCBI Official Full Name
OX-2 membrane glycoprotein
NCBI Official Synonym Full Names
Cd200 molecule
NCBI Official Symbol
Cd200
NCBI Official Synonym Symbols
Mox2; Cspmo2; MRCOX2
NCBI Protein Information
OX-2 membrane glycoprotein
UniProt Protein Name
OX-2 membrane glycoprotein
UniProt Gene Name
Cd200
UniProt Synonym Gene Names
Mox2
UniProt Entry Name
OX2G_RAT

NCBI Description

glycoprotein; involved in neuronal cell-to-cell interaction [RGD, Feb 2006]

Uniprot Description

Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.

Research Articles on Cd200

Similar Products

Product Notes

The Cd200 cd200 (Catalog #AAA7042404) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 31-278aa; full length protein. The amino acid sequence is listed below: QVEVVTQDER KLLHTTASLR CSLKTTQEPL IVTWQKKKAV GPENMVTYSK AHGVVIQPTY KDRINITELG LLNTSITFWN TTLDDEGCYM CLFNMFGSGK VSGTACLTLY VQPIVHLHYN YFEDHLNITC SATARPAPAI SWKGTGSGIE NSTESHSHSN GTTSVTSILR VKDPKTQVGK EVICQVLYLG NVIDYKQSLD KGFWFSVPLL LSIVSLVILL VLISILLYWK RHRNQERGES SQGMQRMK. It is sometimes possible for the material contained within the vial of "OX-2 membrane glycoprotein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.