Cytochrome c biogenesis protein CcsB (ccsB) Recombinant Protein | ccsB recombinant protein
Recombinant Cyanothece sp. Cytochrome c biogenesis protein CcsB (ccsB)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c biogenesis protein CcsB (ccsB); Recombinant Cyanothece sp. Cytochrome c biogenesis protein CcsB (ccsB); ccsB recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-451aa; full length protein
Sequence
MTISDSPQTPENLSLPKQGFRQLIKIVADLRLAIVLLLAIALFSISGTVIEQGETISFYQ QNYPEDPALFGFLTWKVILILGLNHVYTTWWFLSLLVLFGTSLTTCTFTRQFPALKAARK WNFYQKARQFEKLALSTELAINDLKFVNNLLEQKGYKTFQENQAIYARKGIIGKIGPIVV HAAMLIILGGAIWGALTGFLAQAMVPTGSEFKVNNIIEAGPLSQPQIPKDWGIRVNRFWI DYTPDGTIDQFYSDLSVINNDGEELKHKTIYVNEPLRYHGVTFYQTDWGIAGVQAQVNNS PIFQLPMALLNTNGNGRIWGTWIPTKPDLSEGVSLLAKDLQGTMMVYDQKGDLYSAVRPG MILDINGVRLKIYQLIGSTGLQIKADPGIPFVYTGFGLLMMGVIMSYVSHSQIWVLQEDE HCYIGGKTNRSQVTFERELLGIIESLEPEKT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Cyanothece sp. (strain ATCC 51142)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ccsB recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,556 Da
NCBI Official Full Name
MULTISPECIES: cytochrome c biogenesis protein CcsB
UniProt Protein Name
Cytochrome c biogenesis protein CcsB
Protein Family
UniProt Gene Name
ccsB
UniProt Entry Name
CCS1_CYAA5
Uniprot Description
Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment.
Similar Products
Product Notes
The ccsB ccsb (Catalog #AAA7011127) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-451aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ccsB ccsb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTISDSPQTP ENLSLPKQGF RQLIKIVADL RLAIVLLLAI ALFSISGTVI EQGETISFYQ QNYPEDPALF GFLTWKVILI LGLNHVYTTW WFLSLLVLFG TSLTTCTFTR QFPALKAARK WNFYQKARQF EKLALSTELA INDLKFVNNL LEQKGYKTFQ ENQAIYARKG IIGKIGPIVV HAAMLIILGG AIWGALTGFL AQAMVPTGSE FKVNNIIEAG PLSQPQIPKD WGIRVNRFWI DYTPDGTIDQ FYSDLSVINN DGEELKHKTI YVNEPLRYHG VTFYQTDWGI AGVQAQVNNS PIFQLPMALL NTNGNGRIWG TWIPTKPDLS EGVSLLAKDL QGTMMVYDQK GDLYSAVRPG MILDINGVRL KIYQLIGSTG LQIKADPGIP FVYTGFGLLM MGVIMSYVSH SQIWVLQEDE HCYIGGKTNR SQVTFERELL GIIESLEPEK T. It is sometimes possible for the material contained within the vial of "Cytochrome c biogenesis protein CcsB (ccsB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
