C-C chemokine receptor-like 2 (CCRL2) Recombinant Protein | CCRL2 recombinant protein

Recombinant Human C-C chemokine receptor-like 2 (CCRL2)

• Gene Names: CCRL2; HCR; CKRX; CRAM; CRAM-A; CRAM-B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-C chemokine receptor-like 2 (CCRL2); Recombinant Human C-C chemokine receptor-like 2 (CCRL2); Recombinant C-C chemokine receptor-like 2 (CCRL2); C-C chemokine receptor-like 2; Chemokine receptor CCR11 Chemokine receptor X Putative MCP-1 chemokine receptor; CCRL2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-344
• Sequence: MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
• Sequence Length: 356

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 195972795
• NCBI GeneID: 9034
• NCBI Accession #: NP_001124382.1
• NCBI GenBank Nucleotide #: NM_001130910.1
• UniProt Accession #: O00421; O75307; Q4VBB0; Q6IPX0; Q7KYQ9; Q96KP5; Q9UPG0; B4DKQ8
• Molecular Weight: 39,513 Da
• NCBI Official Full Name: C-C chemokine receptor-like 2 isoform 2
• NCBI Official Synonym Full Names: chemokine (C-C motif) receptor-like 2
• NCBI Official Symbol: CCRL2
• NCBI Official Synonym Symbols: HCR; CKRX; CRAM; CRAM-A; CRAM-B
• NCBI Protein Information: C-C chemokine receptor-like 2; chemokine receptor X; chemokine receptor CCR11; putative MCP-1 chemokine receptor
• UniProt Protein Name: C-C chemokine receptor-like 2
• Protein Family: C-C chemokine receptor
• UniProt Gene Name: CCRL2
• UniProt Synonym Gene Names: CCR11; CCR6; CKRX; CRAM; HCR
• UniProt Entry Name: CCRL2_HUMAN

NCBI Description

This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located. [provided by RefSeq, Jul 2008]

Uniprot Description

CCRL2: Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. Plays a critical role for the development of Th2 responses. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p21

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: CCR chemokine receptor binding; chemokine receptor binding; chemokine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; inflammatory response; chemotaxis