Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog (CCR4) Recombinant Protein | CCR4 recombinant protein
Recombinant Nosema ceranae Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog (CCR4)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog (CCR4); Recombinant Nosema ceranae Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog (CCR4); CCR4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-476, Full length protein
Sequence
MEEIQNLKKKNYKSVQKNYSEDYLGLDFSYQGLKHLSYSLFQLTFIKELNLKGNDLENIPGDIYILKNLEILNLSKNKIKFLPAKIGKMINLKELYLSDNFISNIPMELGSLYNCTVFEINNNPLISPFNLLYKDKKLLQYCREHNTNYGPPADRTWLDTVIKKDMSEITFSCGTYNILSNYSAVRLGYPPTWVLNPDYRKENILHNICSINVDILCLQEVETYNYEDFYKDQLELRCEYSSVFQPKGRSKNLTDSKSVDGCATFWKKSKFKIKENLVIDFYSKFINDYRFNKNINLVSRYGKKDNIALISIFEISQTKQTLIVVNVHLYWDPEYEDIKFVQAIILLEELEKVSKCYKNPSIVLLGDFNSLQNSSVYSFITQNSVSNTNLCKYNIGFIPGHFLKLSDAYLSEENDFTNFTPTFKGVIDFIFYSDTLELRSILSTIENEYCDQVVGLPNIHFPSDHIFLASKFKLKK
Sequence Length
476
Species
Nosema ceranae (strain BRL01) (Microsporidian parasite)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,490 Da
UniProt Protein Name
Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog
UniProt Gene Name
CCR4
Uniprot Description
Acts as catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. CCR4 has 3'-5' RNase activity with a strong preference for polyadenylated substrates and also low exonuclease activity towards single-stranded DNA ().
Similar Products
Product Notes
The CCR4 ccr4 (Catalog #AAA1049386) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-476, Full length protein. The amino acid sequence is listed below: MEEIQNLKKK NYKSVQKNYS EDYLGLDFSY QGLKHLSYSL FQLTFIKELN LKGNDLENIP GDIYILKNLE ILNLSKNKIK FLPAKIGKMI NLKELYLSDN FISNIPMELG SLYNCTVFEI NNNPLISPFN LLYKDKKLLQ YCREHNTNYG PPADRTWLDT VIKKDMSEIT FSCGTYNILS NYSAVRLGYP PTWVLNPDYR KENILHNICS INVDILCLQE VETYNYEDFY KDQLELRCEY SSVFQPKGRS KNLTDSKSVD GCATFWKKSK FKIKENLVID FYSKFINDYR FNKNINLVSR YGKKDNIALI SIFEISQTKQ TLIVVNVHLY WDPEYEDIKF VQAIILLEEL EKVSKCYKNP SIVLLGDFNS LQNSSVYSFI TQNSVSNTNL CKYNIGFIPG HFLKLSDAYL SEENDFTNFT PTFKGVIDFI FYSDTLELRS ILSTIENEYC DQVVGLPNIH FPSDHIFLAS KFKLKK. It is sometimes possible for the material contained within the vial of "Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog (CCR4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
