Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-C chemokine receptor 1-like protein 1 (Ccr1l1) Recombinant Protein | Ccr1l1 recombinant protein

Recombinant Mouse C-C chemokine receptor 1-like protein 1 (Ccr1l1)

Gene Names
Ccr1l1; Cmkbr1l1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C chemokine receptor 1-like protein 1 (Ccr1l1); Recombinant Mouse C-C chemokine receptor 1-like protein 1 (Ccr1l1); Recombinant C-C chemokine receptor 1-like protein 1 (Ccr1l1); C-C chemokine receptor 1-like protein 1; Macrophage inflammatory protein 1 alpha receptor-like 1; Ccr1l1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-356
Sequence
MEIPAVTEPSYNTVAKNDFMSGFLCFSINVRAFGITVLTPLYSLVFIIGVIGHVLVVLVLIQHKRLRNMTSIYLFNLAISDLVFLSTLPFWVDYIMKGDWIFGNAMCKFVSGFYYLGLYSDMFFITLLTIDRYLAVVHVVFALRARTVTFGIISSIITWVLAALVSIPCLYVFKSQMEFTYHTCRAILPRKSLIRFLRFQALTMNILGLILPLLAMIICYTRIINVLHRRPNKKKAKVMRLIFVITLLFFLLLAPYYLAAFVSAFEDVLFTPSCLRSQQVDLSLMITEALAYTHCCVNPVIYVFVGKRFRKYLWQLFRRHTAITLPQWLPFLSVDRAQRASATPPSTVEIETSADL
Sequence Length
356
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,849 Da
NCBI Official Full Name
C-C chemokine receptor 1-like protein 1
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor 1-like 1
NCBI Official Symbol
Ccr1l1
NCBI Official Synonym Symbols
Cmkbr1l1
NCBI Protein Information
C-C chemokine receptor 1-like protein 1; MIP-1 alphaRL1; chemokine (C-C) receptor 1-like 1; macrophage inflammatory protein 1 alpha receptor-like 1; macrophage inflammatory protein-1 alpha receptor-like 1
UniProt Protein Name
C-C chemokine receptor 1-like protein 1
UniProt Gene Name
Ccr1l1
UniProt Synonym Gene Names
Cmkbr1l1
UniProt Entry Name
CC1L1_MOUSE

Uniprot Description

CCR1L1: Probable receptor for a C-C type chemokine. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; signal transducer activity; C-C chemokine receptor activity; chemokine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; immune response; signal transduction; inflammatory response; chemotaxis

Similar Products

Product Notes

The Ccr1l1 ccr1l1 (Catalog #AAA1022964) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-356. The amino acid sequence is listed below: MEIPAVTEPS YNTVAKNDFM SGFLCFSINV RAFGITVLTP LYSLVFIIGV IGHVLVVLVL IQHKRLRNMT SIYLFNLAIS DLVFLSTLPF WVDYIMKGDW IFGNAMCKFV SGFYYLGLYS DMFFITLLTI DRYLAVVHVV FALRARTVTF GIISSIITWV LAALVSIPCL YVFKSQMEFT YHTCRAILPR KSLIRFLRFQ ALTMNILGLI LPLLAMIICY TRIINVLHRR PNKKKAKVMR LIFVITLLFF LLLAPYYLAA FVSAFEDVLF TPSCLRSQQV DLSLMITEAL AYTHCCVNPV IYVFVGKRFR KYLWQLFRRH TAITLPQWLP FLSVDRAQRA SATPPSTVEI ETSADL. It is sometimes possible for the material contained within the vial of "C-C chemokine receptor 1-like protein 1 (Ccr1l1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.