Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-C chemokine receptor type 10 (Ccr10) Recombinant Protein | Ccr10 recombinant protein

Recombinant Mouse C-C chemokine receptor type 10 (Ccr10)

Gene Names
Ccr10; Gpr2; Cmkbr9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C chemokine receptor type 10 (Ccr10); Recombinant Mouse C-C chemokine receptor type 10 (Ccr10); Ccr10 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-362aa; full length protein
Sequence
MGTKPTEQVSWGLYSGYDEEAYSVGPLPELCYKADVQAFSRAFQPSVSLMVAVLGLAGNG LVLATHLAARRTTRSPTSVHLLQLALADLLLALTLPFAAAGALQGWNLGSTTCRAISGLY SASFHAGFLFLACISADRYVAIARALPAGQRPSTPSRAHLVSVFVWLLSLFLALPALLFS RDGPREGQRRCRLIFPESLTQTVKGASAVAQVVLGFALPLGVMAACYALLGRTLLAARGP ERRRALRVVVALVVAFVVLQLPYSLALLLDTADLLAARERSCSSSKRKDLALLVTGGLTL VRCSLNPVLYAFLGLRFRRDLRRLLQGGGCSPKPNPRGRCPRRLRLSSCSAPTETHSLSW DN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ccr10 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,900 Da
NCBI Official Full Name
C-C chemokine receptor type 10
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor 10
NCBI Official Symbol
Ccr10
NCBI Official Synonym Symbols
Gpr2; Cmkbr9
NCBI Protein Information
C-C chemokine receptor type 10
UniProt Protein Name
C-C chemokine receptor type 10
Protein Family
UniProt Gene Name
Ccr10
UniProt Synonym Gene Names
Cmkbr9; Gpr2; C-C CKR-10; CC-CKR-10; CCR-10
UniProt Entry Name
CCR10_MOUSE

Uniprot Description

CCR10: Receptor for chemokines SCYA27 and SCYA28. Subsequently transduces a signal by increasing the intracellular calcium ions level and stimulates chemotaxis in a pre-B cell line. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1

Cellular Component: cell surface; integral to membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: C-C chemokine receptor activity; chemokine receptor activity; G-protein coupled receptor activity; protein binding; signal transducer activity

Biological Process: chemotaxis; elevation of cytosolic calcium ion concentration; immune response; signal transduction

Research Articles on Ccr10

Similar Products

Product Notes

The Ccr10 ccr10 (Catalog #AAA7011003) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-362aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ccr10 ccr10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGTKPTEQVS WGLYSGYDEE AYSVGPLPEL CYKADVQAFS RAFQPSVSLM VAVLGLAGNG LVLATHLAAR RTTRSPTSVH LLQLALADLL LALTLPFAAA GALQGWNLGS TTCRAISGLY SASFHAGFLF LACISADRYV AIARALPAGQ RPSTPSRAHL VSVFVWLLSL FLALPALLFS RDGPREGQRR CRLIFPESLT QTVKGASAVA QVVLGFALPL GVMAACYALL GRTLLAARGP ERRRALRVVV ALVVAFVVLQ LPYSLALLLD TADLLAARER SCSSSKRKDL ALLVTGGLTL VRCSLNPVLY AFLGLRFRRD LRRLLQGGGC SPKPNPRGRC PRRLRLSSCS APTETHSLSW DN. It is sometimes possible for the material contained within the vial of "C-C chemokine receptor type 10 (Ccr10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.