Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-C motif chemokine 5 (CCL5) Recombinant Protein | CCL5 recombinant protein

Recombinant Human C-C motif chemokine 5 (CCL5)

Gene Names
CCL5; SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C motif chemokine 5 (CCL5); Recombinant Human C-C motif chemokine 5 (CCL5); EoCPEosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5T cell-specific protein P228 ; TCP228T-cell-specific protein RANTES; CCL5 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-91aa, Full Length of Mature Protein
Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Species
Homo sapiens (Human)
Subcellular Location
Secreted
Protein Families
Intercrine beta (chemokine CC) family
Tissue Specificity
Expressed in the follicular fluid (at protein level). T-cell and macrophage specific.
Pathway
Chemokine signaling pathway
Relevance
Choattractant for blood monocytes, mory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells
Function
Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for CCL5 recombinant protein
References
Multiple pathways of amino terminal processing produce two truncated variants of RANTES/CCL5.Lim J.K., Burns J.M., Lu W., DeVico A.L.J. Leukoc. Biol. 78:442-452(2005)
https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:10632
https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=514821
https://www.genome.jp/dbget-bin/www_bget?hsa:6352
https://string-db.org/network/9606.ENSP00000293272
https://www.omim.org/entry/187011187011187011

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
9,990 Da
NCBI Official Full Name
RANTES
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 5
NCBI Official Symbol
CCL5
NCBI Official Synonym Symbols
SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta
NCBI Protein Information
C-C motif chemokine 5; beta-chemokine RANTES; T-cell specific protein p288; eosinophil chemotactic cytokine; small inducible cytokine subfamily A (Cys-Cys), member 5; regulated upon activation, normally T-expressed, and presumably secreted
UniProt Protein Name
C-C motif chemokine 5
Protein Family
UniProt Gene Name
CCL5
UniProt Synonym Gene Names
D17S136E; SCYA5; TCP228
UniProt Entry Name
CCL5_HUMAN

NCBI Description

This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]

Uniprot Description

CCL5: Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T- cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. By mitogens. T-cell and macrophage specific. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted; Cell adhesion; Motility/polarity/chemotaxis; Secreted, signal peptide; Chemokine

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: protein homodimerization activity; protein self-association; receptor signaling protein tyrosine kinase activator activity; phosphoinositide phospholipase C activity; protein kinase activity; CCR1 chemokine receptor binding; CCR4 chemokine receptor binding; protein binding; chemokine receptor binding; chemokine activity; chemokine receptor antagonist activity; chemoattractant activity; CCR5 chemokine receptor binding; phospholipase activator activity

Biological Process: regulation of chronic inflammatory response; positive regulation of cell adhesion; exocytosis; response to toxin; positive regulation of smooth muscle cell proliferation; positive regulation of JAK-STAT cascade; chemotaxis; positive regulation of smooth muscle cell migration; positive regulation of cell-cell adhesion mediated by integrin; protein amino acid phosphorylation; positive regulation of homotypic cell-cell adhesion; positive regulation of translational initiation; monocyte chemotaxis; leukocyte adhesion; cell-cell signaling; positive chemotaxis; calcium ion transport; positive regulation of innate immune response; protein kinase B signaling cascade; lipopolysaccharide-mediated signaling pathway; dendritic cell chemotaxis; positive regulation of T cell proliferation; inflammatory response; protein tetramerization; phospholipase D activation; positive regulation of viral genome replication; neutrophil activation; negative regulation of G-protein coupled receptor protein signaling pathway; response to virus; MAPKKK cascade; positive regulation of cellular biosynthetic process; macrophage chemotaxis; cellular calcium ion homeostasis; positive regulation of phosphoinositide 3-kinase cascade; G-protein coupled receptor protein signaling pathway; cellular protein complex assembly; positive regulation of tyrosine phosphorylation of STAT protein; negative regulation of viral genome replication; eosinophil chemotaxis; positive regulation of calcium ion transport; regulation of insulin secretion; positive regulation of phosphorylation; positive regulation of epithelial cell proliferation; positive regulation of cell migration; regulation of T cell activation

Research Articles on CCL5

Similar Products

Product Notes

The CCL5 ccl5 (Catalog #AAA717246) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-91aa, Full Length of Mature Protein. The amino acid sequence is listed below: SPYSSDTTPC CFAYIARPLP RAHIKEYFYT SGKCSNPAVV FVTRKNRQVC ANPEKKWVRE YINSLEMS. It is sometimes possible for the material contained within the vial of "C-C motif chemokine 5 (CCL5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.