C-C motif chemokine 16 (CCL16) Recombinant Protein | CCL16 recombinant protein

Recombinant Human C-C motif chemokine 16 (CCL16)

Cat. Num. AAA9018467

• Gene Names: CCL16; LEC; LMC; NCC4; CKb12; HCC-4; LCC-1; Mtn-1; NCC-4; SCYL4; ILINCK; SCYA16
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: C-C motif chemokine 16 (CCL16); Recombinant Human C-C motif chemokine 16 (CCL16); Chemokine CC-4 ; HCC-4; Chemokine LEC; IL-10-inducible chemokine; LCC-1; Liver-expressed chemokineLymphocyte and monocyte chemoattractant ; LMCMonotactin-1 ; MTN-1NCC-4; Small-inducible cytokine A16; CCL16 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-120aa, Full Length of Mature Protein
• Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

• Species: Homo sapiens (Human)
• Relevance: Shows chotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for CCL16 recombinant protein

Immunology

References

Genomic organization of the genes for human and mouse CC chemokine LEC.Fukuda S., Hanano Y., Iio M., Miura R., Yoshie O., Nomiyama H.DNA Cell Biol. 18:275-283(1999)

NCBI and Uniprot Product Information

• NCBI GI #: 4759074
• NCBI GeneID: 6360
• NCBI Accession #: NP_004581.1
• NCBI GenBank Nucleotide #: NM_004590.3
• UniProt Accession #: O15467; Q4KKU0
• Molecular Weight: 13,600 Da
• NCBI Official Full Name: C-C motif chemokine 16
• NCBI Official Synonym Full Names: chemokine (C-C motif) ligand 16
• NCBI Official Symbol: CCL16
• NCBI Official Synonym Symbols: LEC; LMC; NCC4; CKb12; HCC-4; LCC-1; Mtn-1; NCC-4; SCYL4; ILINCK; SCYA16
• NCBI Protein Information: C-C motif chemokine 16; IL-10-inducible chemokine; chemokine LEC; liver CC chemokine-1; liver-expressed chemokine; lymphocyte and monocyte chemoattractant; monotactin-1; new CC chemokine 4; small inducible cytokine subfamily A (Cys-Cys), member 16; small-
• UniProt Protein Name: C-C motif chemokine 16
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL16
• UniProt Synonym Gene Names: ILINCK; NCC4; SCYA16; HCC-4; LMC; MTN-1
• UniProt Entry Name: CCL16_HUMAN

NCBI Description

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10. [provided by RefSeq, Jul 2008]

Uniprot Description

CCL16: Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Motility/polarity/chemotaxis; Chemokine; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: extracellular space; extracellular region

Molecular Function: chemokine activity; chemoattractant activity

Biological Process: cell-cell signaling; positive chemotaxis; cell communication; immune response; chemotaxis; inflammatory response