Coiled-coil domain-containing protein 109B (Ccdc109b) Recombinant Protein | Ccdc109b recombinant protein
Recombinant Mouse Coiled-coil domain-containing protein 109B (Ccdc109b)
Gene Names
Ccdc109b; MCUb; 9030408N13Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Coiled-coil domain-containing protein 109B (Ccdc109b); Recombinant Mouse Coiled-coil domain-containing protein 109B (Ccdc109b); Ccdc109b recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-345aa; full length protein
Sequence
MPGALSGRRMLPSGLCLGRWQLLRTIRARGRGDPRELPSTPQVLCMKLYGNPKYHQALHY GTVEPQDEITVTYKHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAA IITADGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKEEPSGEHMTELENTKSLVHRL FTILHLEEIQKRRERHLMAKIDHLQEQLRPLEQVKAAIEARSEANTSGLLWAGLALLSVQ GGALAWLTWWVYSWDIMEPVTFFLSFANSIVFFAYFIITRQNYTYSSLRSRQFLQFFHKK SQRRCFDVEQYNKLKEDLAEATESLESVRRSLRLRIQGEEASEKN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ccdc109b recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39,799 Da
NCBI Official Full Name
calcium uniporter regulatory subunit MCUb, mitochondrial isoform 2
NCBI Official Synonym Full Names
coiled-coil domain containing 109B
NCBI Official Symbol
Ccdc109b
NCBI Official Synonym Symbols
MCUb; 9030408N13Rik
NCBI Protein Information
calcium uniporter regulatory subunit MCUb, mitochondrial
UniProt Protein Name
Calcium uniporter regulatory subunit MCUb, mitochondrial
UniProt Gene Name
Ccdc109b
UniProt Synonym Gene Names
Mcub; MCUb
UniProt Entry Name
MCUB_MOUSE
Uniprot Description
CCDC109B: Belongs to the MCU family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Cellular Component: integral to membrane; integral to mitochondrial inner membrane; intrinsic to membrane; membrane; mitochondrial inner membrane; mitochondrion
Molecular Function: calcium channel inhibitor activity; ion channel activity; protein binding
Biological Process: calcium ion transport; ion transport; mitochondrial calcium ion homeostasis; mitochondrial calcium ion transport; transport
Research Articles on Ccdc109b
1. Functional characterization of the MCUb protein; shows that it inhibits mitochondrial calcium uptake
Similar Products
Product Notes
The Ccdc109b ccdc109b (Catalog #AAA7010928) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-345aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ccdc109b ccdc109b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPGALSGRRM LPSGLCLGRW QLLRTIRARG RGDPRELPST PQVLCMKLYG NPKYHQALHY GTVEPQDEIT VTYKHGLPLV TLTLPSRKER CQFVVKPMLS TVGSFLQDLQ NEDKGIKTAA IITADGSEIP ASTLMDTLLM TDFKLIINKL RYDIRCHKKE EPSGEHMTEL ENTKSLVHRL FTILHLEEIQ KRRERHLMAK IDHLQEQLRP LEQVKAAIEA RSEANTSGLL WAGLALLSVQ GGALAWLTWW VYSWDIMEPV TFFLSFANSI VFFAYFIITR QNYTYSSLRS RQFLQFFHKK SQRRCFDVEQ YNKLKEDLAE ATESLESVRR SLRLRIQGEE ASEKN. It is sometimes possible for the material contained within the vial of "Coiled-coil domain-containing protein 109B (Ccdc109b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
