Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cobalt transport protein CbiM (cbiM) Recombinant Protein | cbiM recombinant protein

Recombinant Listeria seeligeri serovar 1/2b Cobalt transport protein CbiM (cbiM)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cobalt transport protein CbiM (cbiM); Recombinant Listeria seeligeri serovar 1/2b Cobalt transport protein CbiM (cbiM); Recombinant Cobalt transport protein CbiM (cbiM); Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM; ECF transporter S component CbiM; cbiM recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-244
Sequence
MHIMEGFLPVKWAVFWLIVFIPFLVLGLIRIRKLIAIDKNNKLLLALCAAFIFVLSALKIPSVTGSCSHPTGVGLATVMFGPLVVSVLGVIVLLFQALLLAHGGITTLGANAMSMAVIGPMVGFVVYKLARKLNCNKSVSIFLCAMTADLATYFTTSVQLGVVFPDPASGMMASILKFMAIFCVTQVPIAIAEGLLTVVMYNLISKNLPEKVAQLR
Sequence Length
244
Species
Listeria seeligeri serovar 1/2b (strain ATCC 35967 / DSM 20751 / CIP 100100 / SLCC 3954)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,437 Da
NCBI Official Full Name
cobalamin biosynthesis protein CbiM
NCBI Official Symbol
cbiM
NCBI Protein Information
cobalamin biosynthesis protein CbiM
UniProt Protein Name
Cobalt transport protein CbiM
Protein Family
UniProt Gene Name
cbiM
UniProt Synonym Gene Names
ECF transporter S component CbiM
UniProt Entry Name
CBIM_LISSS

Uniprot Description

Function: Part of the energy-coupling factor (ECF) transporter complex CbiMNOQ involved in cobalt import

By similarity. HAMAP-Rule MF_01462

Pathway: Cofactor biosynthesis; adenosylcobalamin biosynthesis. HAMAP-Rule MF_01462

Subunit structure: Forms an energy-coupling factor (ECF) transporter complex composed of an ATP-binding protein (A component, CbiO), a transmembrane protein (T component, CbiQ) and 2 possible substrate-capture proteins (S components, CbiM and CbiN) of unknown stoichimetry

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity HAMAP-Rule MF_01462.

Sequence similarities: Belongs to the CbiM family.

Similar Products

Product Notes

The cbiM cbim (Catalog #AAA1025735) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-244. The amino acid sequence is listed below: MHIMEGFLPV KWAVFWLIVF IPFLVLGLIR IRKLIAIDKN NKLLLALCAA FIFVLSALKI PSVTGSCSHP TGVGLATVMF GPLVVSVLGV IVLLFQALLL AHGGITTLGA NAMSMAVIGP MVGFVVYKLA RKLNCNKSVS IFLCAMTADL ATYFTTSVQL GVVFPDPASG MMASILKFMA IFCVTQVPIA IAEGLLTVVM YNLISKNLPE KVAQLR. It is sometimes possible for the material contained within the vial of "Cobalt transport protein CbiM (cbiM), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.