Catalase (CAT) Recombinant Protein | CAT recombinant protein
Recombinant Catalase (CAT)
MGHHHHHHSGSEFELRRQAC-GNPVGDKLNV ITVGPRGPLL VQDVVFTDEM AHFDRERIPE RVVHAKGAGA FGYFEVTHDI TKYSKAKVFE HIGKKTPIAV RFSTVAGESG SADTVRDPRG FAVKFYTEDG NWDLVGNNTP IFFIRDPILF PSFIHS
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
NCBI Description
This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide to water and oxygen and thereby mitigates the toxic effects of hydrogen peroxide. Oxidative stress is hypothesized to play a role in the development of many chronic or late-onset diseases such as diabetes, asthma, Alzheimer's disease, systemic lupus erythematosus, rheumatoid arthritis, and cancers. Polymorphisms in this gene have been associated with decreases in catalase activity but, to date, acatalasemia is the only disease known to be caused by this gene. [provided by RefSeq, Oct 2009]
Uniprot Description
Catalase: Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide. Promotes growth of cells including T-cells, B-cells, myeloid leukemia cells, melanoma cells, mastocytoma cells and normal and transformed fibroblast cells. Homotetramer. Belongs to the catalase family.
Protein type: EC 1.11.1.6; Apoptosis; Amino Acid Metabolism - tryptophan; Energy Metabolism - methane; Mitochondrial; Hydrolase; Endoplasmic reticulum; Oxidoreductase
Chromosomal Location of Human Ortholog: 11p13
Cellular Component: Golgi apparatus; peroxisomal membrane; peroxisomal matrix; focal adhesion; membrane; intracellular membrane-bound organelle; endoplasmic reticulum; lysosome; plasma membrane; mitochondrial intermembrane space; peroxisome; cytosol
Molecular Function: antioxidant activity; oxidoreductase activity, acting on peroxide as acceptor; protein homodimerization activity; enzyme binding; catalase activity; metal ion binding; heme binding; NADP binding; aminoacylase activity; receptor binding
Biological Process: cholesterol metabolic process; nucleobase, nucleoside and nucleotide metabolic process; hemoglobin metabolic process; purine base metabolic process; protein homotetramerization; activation of NF-kappaB transcription factor; positive regulation of phosphoinositide 3-kinase cascade; osteoblast differentiation; response to vitamin E; response to reactive oxygen species; triacylglycerol metabolic process; response to hyperoxia; UV protection; inhibition of NF-kappaB transcription factor; hydrogen peroxide catabolic process; ureteric bud development; positive regulation of cell division; aerobic respiration; response to hypoxia; purine nucleotide catabolic process; protein tetramerization; negative regulation of apoptosis; aging
Disease: Acatalasemia
Research Articles on CAT
Similar Products
Product Notes
The CAT cat (Catalog #AAA2010740) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Catalase (CAT) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the CAT cat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with N-terminal His-Tag, its sequence is listed below. MGHHHHHHSG SEFELRRQAC -GNPVGDKLN V ITVGPRGPLL VQDVVFTDEM AHFDRERIPE RVVHAKGAGA FGYFEVTHDI TKYSKAKVFE HIGKKTPIAV RFSTVAGESG SADTVRDPRG FAVKFYTEDG NWDLVGNNTP IFFIRDPILF PSFIHS. It is sometimes possible for the material contained within the vial of "Catalase (CAT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.