GATS-like protein 2 (Gatsl2) Recombinant Protein | Gatsl2 recombinant protein
Recombinant Mouse GATS-like protein 2 (Gatsl2)
Gene Names
Gatsl2; Gats; Gatsl1; Castor2; AW742413; 7530428J21Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GATS-like protein 2 (Gatsl2); Recombinant Mouse GATS-like protein 2 (Gatsl2); Gatsl2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-329, full length protein
Sequence
MELHILEHRLQVASVAKESIPLFTYGLIKLAFLSSKTRCKFFSLTETPEDYTIIVDEEGFLELPSSEHLSVADATWLALNVVSGGGSFSSSQPIGVTKIAKSVIAPLADQNISVFMLSTYQTDFILVRERDLPFVTHTLSSEFTILRVVNGETVAAENLSFTNGFVKPKMVQRPVIHPLSSPSNRFCVTSLDPDTLPAVATLLMDVMFYSNGVKDPMAASDDCGHIRFFSFSLIEGYISLVMDVQTQQRFPSHLLFTSASGELWKMVRIGGQPLGFDECGIVAQISEPLAAADIPAYYISTFKFDHALVPEENISGVIHALKVSQAGKH
Sequence Length
329
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,112 Da
NCBI Official Full Name
cytosolic arginine sensor for mTORC1 subunit 2
NCBI Official Synonym Full Names
GATS protein-like 2
NCBI Official Symbol
Gatsl2
NCBI Official Synonym Symbols
Gats; Gatsl1; Castor2; AW742413; 7530428J21Rik
NCBI Protein Information
cytosolic arginine sensor for mTORC1 subunit 2
UniProt Protein Name
Cytosolic arginine sensor for mTORC1 subunit 2
Protein Family
UniProt Gene Name
Castor2
Uniprot Description
Functions as a negative regulator of the TORC1 signaling pathway through the GATOR complex. As part of homodimers or heterodimers with CASTOR1, directly binds and inhibits the GATOR subcomplex GATOR2 and thereby mTORC1. Does not directly bind arginine, but binding of arginine to CASTOR1 disrupts the interaction of CASTOR2-containing heterodimers with GATOR2 which can in turn activate mTORC1 and the TORC1 signaling pathway.
Similar Products
Product Notes
The Gatsl2 castor2 (Catalog #AAA1393657) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-329, full length protein. The amino acid sequence is listed below: MELHILEHRL QVASVAKESI PLFTYGLIKL AFLSSKTRCK FFSLTETPED YTIIVDEEGF LELPSSEHLS VADATWLALN VVSGGGSFSS SQPIGVTKIA KSVIAPLADQ NISVFMLSTY QTDFILVRER DLPFVTHTLS SEFTILRVVN GETVAAENLS FTNGFVKPKM VQRPVIHPLS SPSNRFCVTS LDPDTLPAVA TLLMDVMFYS NGVKDPMAAS DDCGHIRFFS FSLIEGYISL VMDVQTQQRF PSHLLFTSAS GELWKMVRIG GQPLGFDECG IVAQISEPLA AADIPAYYIS TFKFDHALVP EENISGVIHA LKVSQAGKH. It is sometimes possible for the material contained within the vial of "GATS-like protein 2 (Gatsl2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
