Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calsequestrin-2 (Casq2) Recombinant Protein | Casq2 recombinant protein

Recombinant Mouse Calsequestrin-2 (Casq2)

Gene Names
Casq2; Csq2; cCSQ; ESTM52; AA033488; AW146219
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calsequestrin-2 (Casq2); Recombinant Mouse Calsequestrin-2 (Casq2); Casq2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-415, Full length protein
Sequence
EEGLNFPTYDGKDRVVSLSEKNLKQMLKRYDLLCLYYHEPVSSDKVSQKQFQLKEIVLELVAQVLEHKNIGFVMVDSRKEAKLAKRLGFSEEGSLYVLKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIVNNKLEVQAFERIEDQTKLLGFFKNEDSEYYKAFQEAAEHFQPYIKFFATFDKAVAKKLSLKMNEVGFYEPFMDEPNVIPNKPYTEEELVEFVKEHQRPTLRRLRPEDMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFKPQIGVVNVTDADSIWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDNEDEDDDGDDNDDDDDDDDDNDNSDEDNEDSDDDDDDDE
Sequence Length
396
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Casq2 recombinant protein
This protein specifies the cardiac muscle family member of the calsequestrin family. Calsequestrin is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. The protein is a calcium binding protein that stores calcium for muscle function. Mutations in this gene cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,176 Da
NCBI Official Full Name
calsequestrin-2 isoform 2
NCBI Official Synonym Full Names
calsequestrin 2
NCBI Official Symbol
Casq2
NCBI Official Synonym Symbols
Csq2; cCSQ; ESTM52; AA033488; AW146219
NCBI Protein Information
calsequestrin-2
UniProt Protein Name
Calsequestrin-2
Protein Family
UniProt Gene Name
Casq2

Uniprot Description

Calsequestrin is a high-capacity, moderate affinity, calcium-binding protein and thus acts as an internal calcium store in muscle. Calcium ions are bound by clusters of acidic residues at the protein surface, especially at the interface between subunits. Can bind around 60 Ca2+ ions. Regulates the release of lumenal Ca2+ via the calcium release channel RYR2; this plays an important role in triggering muscle contraction. Plays a role in excitation-contraction coupling in the heart and in regulating the rate of heart beats.

Research Articles on Casq2

Similar Products

Product Notes

The Casq2 casq2 (Catalog #AAA1210680) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-415, Full length protein. The amino acid sequence is listed below: EEGLNFPTYD GKDRVVSLSE KNLKQMLKRY DLLCLYYHEP VSSDKVSQKQ FQLKEIVLEL VAQVLEHKNI GFVMVDSRKE AKLAKRLGFS EEGSLYVLKG DRTIEFDGEF AADVLVEFLL DLIEDPVEIV NNKLEVQAFE RIEDQTKLLG FFKNEDSEYY KAFQEAAEHF QPYIKFFATF DKAVAKKLSL KMNEVGFYEP FMDEPNVIPN KPYTEEELVE FVKEHQRPTL RRLRPEDMFE TWEDDLNGIH IVAFAEKSDP DGYEFLEILK QVARDNTDNP DLSILWIDPD DFPLLVAYWE KTFKIDLFKP QIGVVNVTDA DSIWMEIPDD DDLPTAEELE DWIEDVLSGK INTEDDDNED EDDDGDDNDD DDDDDDDNDN SDEDNEDSDD DDDDDE. It is sometimes possible for the material contained within the vial of "Calsequestrin-2 (Casq2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.