Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Casparian strip membrane protein VIT_08s0007g02880 (VIT_08s0007g02880) Recombinant Protein | LOC100242602 recombinant protein

Recombinant Vitis vinifera Casparian strip membrane protein VIT_08s0007g02880 (VIT_08s0007g02880)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Casparian strip membrane protein VIT_08s0007g02880 (VIT_08s0007g02880); Recombinant Vitis vinifera Casparian strip membrane protein VIT_08s0007g02880 (VIT_08s0007g02880); Recombinant Casparian strip membrane protein VIT_08s0007g02880 (VIT_08s0007g02880); Casparian strip membrane protein VIT_08s0007g02880; LOC100242602 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-209
Sequence
MSSGANATTIDVPETRAEAKGKAPLIAAPIVATTKATPHPNAGWKKGLAIFDFLLRLAAIAATLAAATTMGTTDETLPFFTQFFQFQASFDDLPAFMFFVVATAIASGYLALSLPFSLVSIFRPHAQGIRLLLIISDTVMLALTTAGAASATAIVYLAHNGDSSANWIAICQQFTDFCQSVSGAVVASFIAVVIFMLLVMMSALALRKH
Sequence Length
209
Species
Vitis vinifera (Grape)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,023 Da
NCBI Official Full Name
casparian strip membrane protein VIT_08s0007g02880
NCBI Official Symbol
LOC100242602
NCBI Protein Information
UPF0497 membrane protein 2
UniProt Protein Name
Casparian strip membrane protein VIT_08s0007g02880
UniProt Entry Name
CASP2_VITVI

Uniprot Description

Function: Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion

By similarity.

Subunit structure: Homodimer and heterodimers

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein

By similarity. Note: Very restricted localization following a belt shape within the plasma membrane which coincides with the position of the Casparian strip membrane domain in the root endodermis

By similarity.

Sequence similarities: Belongs to the Casparian strip membrane proteins (CASP) family.

Similar Products

Product Notes

The LOC100242602 (Catalog #AAA1258613) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-209. The amino acid sequence is listed below: MSSGANATTI DVPETRAEAK GKAPLIAAPI VATTKATPHP NAGWKKGLAI FDFLLRLAAI AATLAAATTM GTTDETLPFF TQFFQFQASF DDLPAFMFFV VATAIASGYL ALSLPFSLVS IFRPHAQGIR LLLIISDTVM LALTTAGAAS ATAIVYLAHN GDSSANWIAI CQQFTDFCQS VSGAVVASFI AVVIFMLLVM MSALALRKH. It is sometimes possible for the material contained within the vial of "Casparian strip membrane protein VIT_08s0007g02880 (VIT_08s0007g02880), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.