Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Caspase-1 (CASP1) Recombinant Protein | CASP1 recombinant protein

Recombinant Horse Caspase-1 (CASP1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Caspase-1 (CASP1); Recombinant Horse Caspase-1 (CASP1); CASP1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
120-298, Full length protein
Sequence
DLAKLALSGPKVSLKLCSPEVVERIWKEKSAEMYPIMGKSMTRTRLALIICNTEFDNLSRRAGAEVDIASMKVLLEGLGYSVEVKENLTALDMTTELKAFAARPEHRSSDSTFLVFMSHGIREGICGKKFSEKVPDVLEVNTIFQIFNTRNCPNLRDKPKVIIIQACRGENQGVVWLKD
Sequence Length
179
Species
Equus caballus (Horse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CASP1 recombinant protein
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing of this gene results in five transcript variants encoding distinct isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,331 Da
NCBI Official Full Name
caspase-1
NCBI Official Synonym Full Names
caspase 1
NCBI Official Symbol
CASP1
NCBI Protein Information
caspase-1
UniProt Protein Name
Caspase-1
UniProt Gene Name
CASP1
UniProt Synonym Gene Names
IL1BC; CASP-1; IL-1BC; ICE; IL-1 beta-converting enzyme

Uniprot Description

Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive.

Similar Products

Product Notes

The CASP1 casp1 (Catalog #AAA1359306) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 120-298, Full length protein. The amino acid sequence is listed below: DLAKLALSGP KVSLKLCSPE VVERIWKEKS AEMYPIMGKS MTRTRLALII CNTEFDNLSR RAGAEVDIAS MKVLLEGLGY SVEVKENLTA LDMTTELKAF AARPEHRSSD STFLVFMSHG IREGICGKKF SEKVPDVLEV NTIFQIFNTR NCPNLRDKPK VIIIQACRGE NQGVVWLKD. It is sometimes possible for the material contained within the vial of "Caspase-1 (CASP1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.