Cathelin-related antimicrobial peptide (Camp) Recombinant Protein | Camp recombinant protein
Recombinant Mouse Cathelin-related antimicrobial peptide (Camp), partial
Gene Names
Camp; Cnlp; MCLP; CAP18; Cramp; FALL39
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cathelin-related antimicrobial peptide (Camp); Recombinant Mouse Cathelin-related antimicrobial peptide (Camp); partial; Camp recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
135-172. Full Length of Mature Protein
Sequence
ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,453 Da
NCBI Official Full Name
cathelicidin antimicrobial peptide
NCBI Official Synonym Full Names
cathelicidin antimicrobial peptide
NCBI Official Symbol
Camp
NCBI Official Synonym Symbols
Cnlp; MCLP; CAP18; Cramp; FALL39
NCBI Protein Information
cathelicidin antimicrobial peptide
UniProt Protein Name
Cathelicidin antimicrobial peptide
Protein Family
UniProt Gene Name
Camp
UniProt Synonym Gene Names
Cramp
NCBI Description
This gene encodes a member of the cathelicidin family of antimicrobial peptides that play an important role in the defense against microbial infection. The encoded preproprotein undergoes proteolytic processing to generate a mature polypeptide before secretion by host cells such as neutrophils, epithelial cells and macrophages. Mice lacking the encoded protein exhibit increased susceptibility to group A streptococcus and Escherichia coli infections. [provided by RefSeq, Oct 2015]
Uniprot Description
Acts as a potent antimicrobial peptide.
Research Articles on Camp
Similar Products
Product Notes
The Camp camp (Catalog #AAA966598) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 135-172. Full Length of Mature Protein. The amino acid sequence is listed below: ISRLAGLLRK GGEKIGEKLK KIGQKIKNFF QKLVPQPE. It is sometimes possible for the material contained within the vial of "Cathelin-related antimicrobial peptide (Camp), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
