Proliferating cell nuclear antigen Recombinant Protein | CALM2 recombinant protein

Recombinant human Proliferating cell nuclear antigen

Cat. Num. AAA717126

• Gene Names: CALM2; PHKD; CALM1; CALM3; CAMII; PHKD2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Proliferating cell nuclear antigen; Recombinant human Proliferating cell nuclear antigen; Recombinant human Calmodulin protein; CALM2 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence: MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

Related Product Information for CALM2 recombinant protein

Calmodulin mediates the control of a large number of enzymes and other proteins by Ca2+. Among the enzymes to be stimulated by the calmodulin-Ca2+ complex are a number of protein kinases and phosphatases. Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis.

References

[1] "Isolation and nucleotide sequence of a cDNA encoding human calmodulin."

NCBI and Uniprot Product Information

• NCBI GI #: 229577210
• NCBI GeneID: 805
• NCBI Accession #: NP_001734.1
• NCBI GenBank Nucleotide #: NM_001743.4
• UniProt Accession #: P62158; P02593; P70667; P99014; Q13942; Q53S29; Q61379; Q61380; Q96HK3
• Molecular Weight: 43 KD
• NCBI Official Full Name: Homo sapiens calmodulin 2 (phosphorylase kinase, delta) (CALM2), mRNA
• NCBI Official Synonym Full Names: calmodulin 2 (phosphorylase kinase, delta)
• NCBI Official Symbol: CALM2
• NCBI Official Synonym Symbols: PHKD; CALM1; CALM3; CAMII; PHKD2
• NCBI Protein Information: calmodulin; caM; LP7057 protein; phosphorylase kinase delta
• UniProt Protein Name: Calmodulin
• Protein Family: Proliferating cell nuclear antigen
• UniProt Gene Name: CALM1
• UniProt Synonym Gene Names: CALM; CAM; CAM1; CaM
• UniProt Entry Name: CALM_HUMAN

NCBI Description

This gene is a member of the calmodulin gene family. There are three distinct calmodulin genes dispersed throughout the genome that encode the identical protein, but differ at the nucleotide level. Calmodulin is a calcium binding protein that plays a role in signaling pathways, cell cycle progression and proliferation. Several infants with severe forms of long-QT syndrome (LQTS) who displayed life-threatening ventricular arrhythmias together with delayed neurodevelopment and epilepsy were found to have mutations in either this gene or another member of the calmodulin gene family (PMID:23388215). Mutations in this gene have also been identified in patients with less severe forms of LQTS (PMID:24917665), while mutations in another calmodulin gene family member have been associated with catecholaminergic polymorphic ventricular tachycardia (CPVT)(PMID:23040497), a rare disorder thought to be the cause of a significant fraction of sudden cardiac deaths in young individuals. Pseudogenes of this gene are found on chromosomes 10, 13, and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2015]

Uniprot Description

Function: Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca2+. Among the enzymes to be stimulated by the calmodulin-Ca2+ complex are a number of protein kinases and phosphatases. Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis. Ref.21

Subunit structure: Interacts with MYO1C and RRAD. Interacts with MYO10

By similarity. Interacts with CEP97, CEP110, TTN/titin and SRY. Interacts with USP6; the interaction is calcium dependent. Interacts with CDK5RAP2. Interacts with SCN5A. Interacts with RYR1 and RYR2. Interacts with FCHO1. Ref.16 Ref.17 Ref.18 Ref.19 Ref.21 Ref.22 Ref.26 Ref.32 Ref.34

Subcellular location: Cytoplasm › cytoskeleton › spindle. Cytoplasm › cytoskeleton › spindle pole. Note: Distributed throughout the cell during interphase, but during mitosis becomes dramatically localized to the spindle poles and the spindle microtubules. Ref.21

Post-translational modification: Ubiquitination results in a strongly decreased activity

By similarity.Phosphorylation results in a decreased activity

By similarity.

Miscellaneous: This protein has four functional calcium-binding sites.

Sequence similarities: Belongs to the calmodulin family.Contains 4 EF-hand domains.

Sequence caution: The sequence CAA36839.1 differs from that shown. Reason: Erroneous gene model prediction.