Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Voltage-dependent calcium channel gamma-2 subunit (Cacng2) Recombinant Protein | Cacng2 recombinant protein

Recombinant Mouse Voltage-dependent calcium channel gamma-2 subunit (Cacng2)

Gene Names
Cacng2; stg; wag; waggler; AW060990; stargazer; stargazin; B230105C07Rik; B930041E13Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Voltage-dependent calcium channel gamma-2 subunit (Cacng2); Recombinant Mouse Voltage-dependent calcium channel gamma-2 subunit (Cacng2); Cacng2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-323aa; Full length protein
Sequence
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS SRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRDNSFLQVH NCIQKDSKDSLHANTANRRTTPV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Cacng2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,895 Da
NCBI Official Full Name
voltage-dependent calcium channel gamma-2 subunit
NCBI Official Synonym Full Names
calcium channel, voltage-dependent, gamma subunit 2
NCBI Official Symbol
Cacng2
NCBI Official Synonym Symbols
stg; wag; waggler; AW060990; stargazer; stargazin; B230105C07Rik; B930041E13Rik
NCBI Protein Information
voltage-dependent calcium channel gamma-2 subunit
UniProt Protein Name
Voltage-dependent calcium channel gamma-2 subunit
UniProt Gene Name
Cacng2
UniProt Synonym Gene Names
Stg; TARP gamma-2
UniProt Entry Name
CCG2_MOUSE

Uniprot Description

Stargazin: Regulates the trafficking and gating properties of AMPA- selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state. The L-type calcium channel is composed of five subunits: alpha-1, alpha-2/delta, beta and gamma. Interacts with the PDZ domains of DLG4/PSD-95 and DLG1/SAP97. May interact with GOPC. Acts as an auxiliary subunit for AMPA-selective glutamate receptors (AMPARs). Found in a complex with GRIA1, GRIA2, GRIA3, GRIA4, CNIH2, CNIH3, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8. Interacts with GRIA1. Brain. Belongs to the PMP-22/EMP/MP20 family. CACNG subfamily.

Protein type: Membrane protein, multi-pass; Channel, calcium; Membrane protein, integral

Cellular Component: integral to membrane; membrane; voltage-gated calcium channel complex

Molecular Function: calcium channel activity; channel regulator activity; ionotropic glutamate receptor binding; voltage-gated calcium channel activity; voltage-gated ion channel activity

Biological Process: calcium ion transport; ion transport; membrane depolarization; membrane hyperpolarization; neurological system process; neuromuscular junction development; regulation of membrane potential; transmission of nerve impulse; transport

Research Articles on Cacng2

Similar Products

Product Notes

The Cacng2 cacng2 (Catalog #AAA7010683) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-323aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Cacng2 cacng2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGLFDRGVQM LLTTVGAFAA FSLMTIAVGT DYWLYSRGVC KTKSVSENET SKKNEEVMTH SGLWRTCCLE GNFKGLCKQI DHFPEDADYE ADTAEYFLRA VRASSIFPIL SVILLFMGGL CIAASEFYKT RHNIILSAGI FFVSAGLSNI IGIIVYISAN AGDPSKSDSK KNSYSYGWSF YFGALSFIIA EMVGVLAVHM FIDRHKQLRA TARATDYLQA SAITRIPSYR YRYQRRSRSS SRSTEPSHSR DASPVGVKGF NTLPSTEISM YTLSRDPLKA ATTPTATYNS DRDNSFLQVH NCIQKDSKDS LHANTANRRT TPV. It is sometimes possible for the material contained within the vial of "Voltage-dependent calcium channel gamma-2 subunit (Cacng2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.