CDK5 and ABL1 enzyme substrate 1 (CABLES1) Recombinant Protein | CABLES1 recombinant protein

Recombinant Human CDK5 and ABL1 enzyme substrate 1 (CABLES1)

Cat. Num. AAA1365665

• Gene Names: CABLES1; CABL1; IK3-1; CABLES; HsT2563
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: CDK5 and ABL1 enzyme substrate 1 (CABLES1); Recombinant Human CDK5 and ABL1 enzyme substrate 1 (CABLES1); CABLES1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-633, Full length protein
• Sequence: MAAAAAAATTAACSSGSAGTDAAGASGLQQPPPQPQPQPAAAAPAQPPPEPPRKPRMDPRRRQAALSFLTNISLDGRLPPQDAEWGGGEEGGAAKPGAGGACGARTRFSLLAAAERGGCIALAAPGTPAAGLAAGSGPCLPQPSSLPPLIPGGHATVSGPGVARGFASPLGAGRASGEQWQPPRPAPLAACAQLQLLDGSGAAGQEELEEDDAFISVQVPAAAFLGSGTPGSGSGSRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSIFSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTSSFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVKPSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLVQSS
• Sequence Length: 633

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 154759423
• NCBI GeneID: 91768
• NCBI Accession #: NP_001094089.1
• NCBI GenBank Nucleotide #: NM_001100619.2
• UniProt Accession #: Q8TDN4; Q8N3Y8; Q8NA22; Q9BTG1; B4DK60
• Molecular Weight: 34,593 Da
• NCBI Official Full Name: CDK5 and ABL1 enzyme substrate 1 isoform 2
• NCBI Official Synonym Full Names: Cdk5 and Abl enzyme substrate 1
• NCBI Official Symbol: CABLES1
• NCBI Official Synonym Symbols: CABL1; IK3-1; CABLES; HsT2563
• NCBI Protein Information: CDK5 and ABL1 enzyme substrate 1
• UniProt Protein Name: CDK5 and ABL1 enzyme substrate 1
• Protein Family: CDK5 and ABL1 enzyme substrate
• UniProt Gene Name: CABLES1
• UniProt Synonym Gene Names: CABLES; Ik3-1

NCBI Description

This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kinases. One study (PMID: 16177568) reported aberrant splicing of transcripts from this gene which results in removal of the cyclin binding domain only in human cancer cells, and reduction in gene expression was shown in colorectal cancers (PMID: 17982127).Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

Cyclin-dependent kinase binding protein. Enhances cyclin-dependent kinase tyrosine phosphorylation by nonreceptor tyrosine kinases, such as that of CDK5 by activated ABL1, which leads to increased CDK5 activity and is critical for neuronal development, and that of CDK2 by WEE1, which leads to decreased CDK2 activity and growth inhibition. Positively affects neuronal outgrowth. Plays a role as a regulator for p53/p73-induced cell death ().