Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chlorophyll a-b binding protein 22L, chloroplastic (CAB22L) Recombinant Protein | CAB22L recombinant protein

Recombinant Petunia sp. Chlorophyll a-b binding protein 22L, chloroplastic (CAB22L)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Chlorophyll a-b binding protein 22L; chloroplastic (CAB22L); Recombinant Petunia sp. Chlorophyll a-b binding protein 22L; Recombinant Chlorophyll a-b binding protein 22L; chloroplastic; LHCII type I CAB-22L; LHCP; CAB22L recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
36-267
Sequence
RKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWLKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVLLMGAVEGYRVAGGPLGVVVDPLYPGGSFDPLGLAEDPEAFAELKVKETKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLVDPVNNNAWSYATNFVPRK
Sequence Length
267
Species
Petunia sp. (Petunia)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
28,408 Da
NCBI Official Full Name
Chlorophyll a-b binding protein 22L, chloroplastic
UniProt Protein Name
Chlorophyll a-b binding protein 22L, chloroplastic
UniProt Gene Name
CAB22L
UniProt Synonym Gene Names
LHCP
UniProt Entry Name
CB22_PETSP

Uniprot Description

Function: The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.

Cofactor: Binds at least 14 chlorophylls (8 Chl-a and 6 Chl-b) and carotenoids such as lutein and neoxanthin

By similarity.

Subunit structure: The LHC complex consists of chlorophyll a-b binding proteins.

Subcellular location: Plastid › chloroplast thylakoid membrane; Multi-pass membrane protein.

Domain: The N-terminus of the protein extends into the stroma where it is involved with adhesion of granal membranes and post-translational modifications; both are believed to mediate the distribution of excitation energy between photosystems I and II.

Post-translational modification: Photoregulated by reversible phosphorylation of its threonine residues

By similarity.

Miscellaneous: There are at least 16 genes for the major CAB protein which can be classified into at least 5 small multigene families.

Sequence similarities: Belongs to the light-harvesting chlorophyll a/b-binding (LHC) protein family.

Similar Products

Product Notes

The Chlorophyll a-b binding protein 22L, chloroplastic (CAB22L) cab22l (Catalog #AAA1172832) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 36-267. The amino acid sequence is listed below: RKTATKAKPV SSGSPWYGPD RVKYLGPFSG EAPSYLTGEF PGDYGWDTAG LSADPETFAK NRELEVIHCR WAMLGALGCV FPELFARNGV KFGEAVWLKA GSQIFSEGGL DYLGNPSLVH AQSILAIWAC QVLLMGAVEG YRVAGGPLGV VVDPLYPGGS FDPLGLAEDP EAFAELKVKE TKNGRLAMFS MFGFFIQAIV TGKGPLENLA DHLVDPVNNN AWSYATNFVP RK. It is sometimes possible for the material contained within the vial of "Chlorophyll a-b binding protein 22L, chloroplastic (CAB22L), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.